PARK2/Parkin Monoclonal antibody, PBS Only

• 

  WB analysis of HEK-293 using 66674-1-Ig (same clone as 66674-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  WB analysis of SH-SY5Y using 66674-1-Ig (same clone as 66674-1-PBS)

  SH-SY5Y cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  WB analysis of U-251 using 66674-1-Ig (same clone as 66674-1-PBS)

  U-251 cells were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 66674-1-Ig (same clone as 66674-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 66674-1-Ig (Parkin antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66674-1-Ig (same clone as 66674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66674-1-Ig (Parkin antibody) at dilution of 1:500 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 66674-1-Ig (same clone as 66674-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 66674-1-Ig (Parkin antibody) at dilution of 1:500 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• 

  IF Staining of RAW 264.7 using 66674-1-Ig (same clone as 66674-1-PBS)

  Immunofluorescent analysis of (-20°C Ethanol) fixed RAW 264.7 cells using PARK2/Parkin antibody (66674-1-Ig, Clone: 2H5A7 ) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L) (SA00013-1), CL594-Phalloidin (red). This data was developed using the same antibody clone with 66674-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

PARK2/Parkin Monoclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 66674-1-PBS

Clone No.2H5A7

Host / Isotype

Mouse / IgG2b

Reactivity

human, mouse

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

Parkin, PARK2, Parkin RBR E3 ubiquitin-protein ligase, EC:2.3.2.31, E3 ubiquitin-protein ligase parkin

---

Product Information

66674-1-PBS targets PARK2/Parkin in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Mouse / IgG2b
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag5179

  Product name: Recombinant human Parkin protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 81-387 aa of BC022014

  Sequence: NATGGDDPRNAAGGCEREPQSLTRVDLSSSVLPGDSVGLAVILHTDSRKDSPPAGSPAGRSIYNSFYVYCKGPCQRVQPGKLRVQCSTCRQATLTLTQGPSCWDDVLIPNRMSGECQSPHCPGTSAEFFFKCGAHPTSDKETSVALHLIATNSRNITCITCTDVRSPVLVFQCNSRHVICLDCFHLYCVTRLNDRQFVHDPQLGYSLPCVGTGDTVVLRGALGGFRRGVAGCPNSLIKELHHFRILGEEQYNRYQQYGAEECVLQMGGVLCPRPGCGAGLLPEPDQRKVTCEGGNGLGCGYGQRRTK

• Full Name: Parkinson disease (autosomal recessive, juvenile) 2, parkin
• Calculated Molecular Weight: 52 kDa
• Observed Molecular Weight: 42-52 kDa
• GenBank Accession Number: BC022014
• Gene Symbol: Parkin
• Gene ID (NCBI): 5071
• RRID: AB_2882028
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: O60260
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Parkin, a RING-type E3 ubiquitin-protein ligase, is involved in the ubiquitination pathway and contributes to protection from neurotoxicity induced by unfolded protein stresses. Its ubiquitin-protein ligase activity promotes the degradation of a viariety of proteins including itself. Mutations in Parkin are implicated in the pathogenesis of autosomal recessive familial Parkinson's disease. It has 8 isoforms produced by alternative splicing.