Tested Applications
| Positive IF/ICC detected in | HeLa cells |
| Positive FC (Intra) detected in | Hela cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Immunofluorescence (IF)/ICC | IF/ICC : 1:500-1:2000 |
| Flow Cytometry (FC) (INTRA) | FC (INTRA) : 0.2 μg per 10^6 cells in a 100 µl suspension |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60919-2-Ig targets Pericentrin in IF/ICC, FC (Intra), ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Mouse / IgM |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27248 Product name: Recombinant human PCNT protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 100-200 aa of AK093923 Sequence: MDLEQLQQKQVNDHPPEQCGMFTVSDHPPEQHGMFTVGDHPPEQRGMFTVSDHPPEQHGMFTVSDHPPEQRGMFTISDHQPEQRGMFTVSDHTPEQRGIFTI Predict reactive species |
| Full Name | pericentrin |
| Calculated Molecular Weight | 378 kDa |
| GenBank Accession Number | AK093923 |
| Gene Symbol | Pericentrin |
| Gene ID (NCBI) | 5116 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Caprylic acid/ammonium sulfate precipitation |
| UNIPROT ID | O95613 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Pericentrin (PCNT) is a large, highly conserved centrosomal protein essential for organizing the pericentriolar material (PCM)-the matrix surrounding the centrioles that nucleates and anchors microtubules. It acts as a scaffold that recruits and positions key regulatory complexes, including γ-tubulin ring complexes (γ-TuRCs), protein kinase A (PKA) and dynein, thereby orchestrating microtubule nucleation, spindle assembly and centrosome maturation throughout the cell cycle











