Periostin Polyclonal antibody, PBS Only

• 

  IHC staining of human skin cancer using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 19899-1-AP (Periostin antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human skin cancer using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human skin cancer tissue slide using 19899-1-AP (Periostin antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19899-1-AP (Periostin antibody at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human colon using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human colon tissue slide using 19899-1-AP (Periostin antibody at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19899-1-AP (Periostin antibody at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 19899-1-AP (same clone as 19899-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer tissue slide using 19899-1-AP (Periostin antibody at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 19899-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

Periostin Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 19899-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

IHC, Indirect ELISA

Synonyms

OSF 2, OSF2, OSF-2, Osteoblast specific factor 2, Osteoblast-specific factor 2

---

Product Information

19899-1-PBS targets Periostin in IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag13791

  Product name: Recombinant human POSTN protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 21-368 aa of BC106710

  Sequence: ANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPD

• Full Name: periostin, osteoblast specific factor
• Calculated Molecular Weight: 93 kDa
• GenBank Accession Number: BC106710
• Gene Symbol: Periostin
• Gene ID (NCBI): 10631
• RRID: AB_10732682
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15063
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. The isoforms of periostin are between 83 and 93 kDa in mass and differ in their C-terminal sequences, characterized by individual presence or absence of cassette exons 17-21 (UniProtKB/Swiss-Prot,PMID: 21997759).