• Featured Product
  • KD/KO Validated

Periostin Monoclonal antibody

Periostin Monoclonal Antibody for WB, IHC, IF-P, IF-Fro, ELISA

Cat No. 66491-1-Ig
Clone No.1A11A3

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IHC, IF-P, IF-Fro, ELISA

1A11A3, OSF 2, OSF2, OSF-2, Osteoblast specific factor 2

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inSK-N-SH cells, BxPC-3 cells, HEK-293 cells, human placenta tissue, MCF-7 cells, Neuro-2a cells, SGC-7901 cells, ROS1728 cells, BT-549 cells
Positive IHC detected inhuman breast cancer tissue, human colon tissue, human colon cancer tissue, human stomach tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF-P detected inhuman breast cancer tissue
Positive IF-Fro detected inmouse breast cancer

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:4000-1:16000
Immunofluorescence (IF)-PIF-P : 1:4000-1:16000
Immunofluorescence (IF)-FROIF-FRO : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

66491-1-Ig targets Periostin in WB, IHC, IF-P, IF-Fro, ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity human, mouse, rat
Cited Reactivityhuman, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag14487

Product name: Recombinant human POSTN protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 21-368 aa of BC106710

Sequence: ANNHYDKILAHSRIRGRDQGPNVCALQQILGTKKKYFSTCKNWYKKSICGQKTTVLYECCPGYMRMEGMKGCPAVLPIDHVYGTLGIVGATTTQRYSDASKLREEIEGKGSFTYFAPSNEAWDNLDSDIRRGLESNVNVELLNALHSHMINKRMLTKDLKNGMIIPSMYNNLGLFINHYPNGVVTVNCARIIHGNQIATNGVVHVIDRVLTQIGTSIQDFIEAEDDLSSFRAAAITSDILEALGRDGHFTLFAPTNEAFEKLPRGVLERIMGDKVASEALMKYHILNTLQCSESIMGGAVFETLEGNTIEIGCDGDSITVNGIKMVNKKDIVTNNGVIHLIDQVLIPD

Predict reactive species
Full Name periostin, osteoblast specific factor
Calculated Molecular Weight 93 kDa
Observed Molecular Weight 85-90 kDa
GenBank Accession NumberBC106710
Gene Symbol Periostin
Gene ID (NCBI) 10631
RRIDAB_2881856
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDQ15063
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

Periostin (POSTN, PN), originally named as osteoblast-specific factor 2 (OSF-2), is a 90-kDa secreted protein which is now classified as a matricellular protein. It is present in a wide variety of normal adult tissues and fetal tissues, and has a role in bone, tooth and heart development and function. Studies show that periostin is overexpressed in a broad range of human cancer types, including lung, ovary, breast and colon cancers. Recent evidence reveals that periostin is expressed by fibroblasts in the normal tissue and in the stroma of the primary tumour, and it is required to allow cancer stem cell maintenance. The isoforms of periostin are between 83 and 93 kDa in mass and differ in their C-terminal sequences, characterized by individual presence or absence of cassette exons 17-21 (UniProtKB/Swiss-Prot, PMID: 21997759).

Protocols

Product Specific Protocols
IF protocol for Periostin antibody 66491-1-IgDownload protocol
IHC protocol for Periostin antibody 66491-1-IgDownload protocol
WB protocol for Periostin antibody 66491-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
mouseWB,IF

Cell Metab

Myocardial infarction accelerates the progression of MASH by triggering immunoinflammatory response and induction of periosti

Authors - Wei Xie
mouseIHC

Adv Sci (Weinh)

Spatiotemporal Characterization of Human Early Intervertebral Disc Formation at Single-Cell Resolution

Authors - Taifeng Zhou
humanWB,IHC

Mol Ther

Self-amplifying loop of NF-κB and periostin initiated by PIEZO1 accelerates mechano-induced senescence of nucleus pulposus cells and intervertebral disc degeneration.

Authors - Jinna Wu
humanWB,IHC

Cancer Cell Int

Periostin promotes the proliferation and metastasis of osteosarcoma by increasing cell survival and activates the PI3K/Akt pathway.

Authors - Chaojian Xu
  • KD Validated
mouseWB

Biochem Biophys Res Commun

Changed PGA and POSTN levels in choroid plexus are associated with depressive-like behaviors in mice.

Authors - Jie Liu
humanIHC

Aging (Albany NY)

An immune signature to predict the prognosis of ATRX-wildtype glioma patients and guide immune checkpoint blockade therapy

Authors - Wenpeng Cao

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.


FH

Niklas (Verified Customer) (11-08-2022)

great staining with even a high dilution factor

  • Applications: Immunofluorescence
  • Primary Antibody Dilution: 1:500
  • Cell Tissue Type: human fibroblasts
Loading...
||
New chat

Able

正在加载,请稍候...