Anti-Human Prion protein PrP/CD230 Rabbit Recombinant Antibody, PBS Only

• 

  FC experiment of human PBMCs using 98414-4-RR (same clone as 98414-4-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human Prion protein PrP/CD230 Rabbit RecAb (98414-4-RR, Clone: 243104D11) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were then stained with CoraLite® Plus 647 Anti-Human CD14. Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98414-4-PBS in a different storage buffer formulation.

• 

  FC experiment of human PBMCs using 98414-4-RR (same clone as 98414-4-PBS)

  1x10^6 human PBMCs were surface stained with 0.25 ug Anti-Human Prion protein PrP/CD230 Rabbit RecAb (98414-4-RR, Clone: 243104D11) (red) or Rabbit IgG Isotype Control RecAb (98136-1-RR, Clone: 240953C9) (blue), and PE-Conjugated Goat Anti-Rabbit IgG(H+L). Cells were incubated with FC Receptor Block prior to staining. Cells were not fixed. This data was developed using the same antibody clone with 98414-4-PBS in a different storage buffer formulation.

Prion protein PrP/CD230 Uni-rAb^® Recombinant Antibody for FC

Cat No. 98414-4-PBS

Clone No.243104D11

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

FC

Synonyms

Prion protein PrP, PRNP, PrP, Alternative prion protein, AltPrP

---

Product Information

98414-4-PBS targets Prion protein PrP/CD230 in FC applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg3359

  Product name: Recombinant Human Prion protein PrP protein (rFc Tag)

  Source: mammalian cells-derived, pHZ-KIsec-C-rFc

  Tag: C-rFc

  Domain: 23-229 aa of BC012844

  Sequence: KKRPKPGGWNTGGSRYPGQGSPGGNRYPPQGGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQPHGGGWGQGGGTHSQWNKPSKPKTNMKHMAGAAAAGAVVGGLGGYMLGSAMSRPIIHFGSDYEDRYYRENMHRYPNQVYYRPMDEYSNQNNFVHDCVNITIKQHTVTTTTKGENFTETDVKMMERVVEQMCITQYERESQAYYQRG

• Full Name: prion protein
• GenBank Accession Number: BC012844
• Gene Symbol: PrP
• Gene ID (NCBI): 5621
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: P04156
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The major prion protein (PrP), also known as CD230, is encoded by the prion protein-encoding gene (PRNP). PrP is widely expressed in a variety of tissues and is abundant in the nervous system and participates in neuronal growth and survival. PrP expression is strongly associated with immune infiltrating cells, immunosuppressive cell infiltration and immune checkpoint molecules. PrP is an immune-related prognostic marker that holds promise for predicting outcomes related to colorectal cancer immunotherapy.