ProSAPiP1 Polyclonal antibody, PBS Only

• 

  WB analysis using 24936-1-AP (same clone as 24936-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24936-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 24936-1-AP (same clone as 24936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24936-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat brain using 24936-1-AP (same clone as 24936-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 24936-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 24936-1-AP (same clone as 24936-1-PBS)

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ProSAPiP1 antibody (24936-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 24936-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

ProSAPiP1 Polyclonal Antibody for WB, IHC, IF/ICC, Indirect ELISA

Cat No. 24936-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, Indirect ELISA

Synonyms

ProSAPiP 1, ProSAP-interacting protein 1, LZTS3, Leucine zipper putative tumor suppressor 3, KIAA0552

---

Product Information

24936-1-PBS targets ProSAPiP1 in WB, IHC, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20765

  Product name: Recombinant human ProSAPiP1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 328-627 aa of BC038860

  Sequence: LWEKEQEVAALRRSLEQSEAAVAQQDKKQLQEEAARLMRQREELEDKVAACQKEQADFLPRIEETKWEVCQKAGEISLLKQQLKDSQADVSQKLSEIVGLRSQLREGRASLREKEEQLLSLRDSFSSKQASLELGEGELPAACLKPALTPVDPAEPQDALATCESDEAKMRRQAGVAAAASLVYVDGEAEAGGESGTRALRREVGRLQAELAAERRARERQGASFAEERRVWLEEKEKVIEYQKQLQLSYVEMYQRNQQLERRLRERGAAGGASTPTPQHGEEKKAWTPSRLERIESTEI

• Full Name: ProSAPiP1 protein
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC038860
• Gene Symbol: ProSAPiP1
• Gene ID (NCBI): 9762
• RRID: AB_2714022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60299
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.