ProSAPiP1 Polyclonal antibody

• 

  WB analysis using 24936-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of rat brain using 24936-1-AP

  Immunohistochemical analysis of paraffin-embedded rat brain tissue slide using 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:1000 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24936-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24936-1-AP (ProSAPiP1 antibody) at dilution of 1:800 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 24936-1-AP

  Immunofluorescent analysis of (-20°C Methanol) fixed HeLa cells using ProSAPiP1 antibody (24936-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

ProSAPiP1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24936-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

ProSAPiP 1, ProSAP-interacting protein 1, LZTS3, Leucine zipper putative tumor suppressor 3, KIAA0552

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse brain tissue, rat brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:400-1:1600
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 2 publications below
• IP: See 1 publications below

Product Information

24936-1-AP targets ProSAPiP1 in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20765

  Product name: Recombinant human ProSAPiP1 protein

  Source: e coli.-derived, PET30a

  Tag: 6*His

  Domain: 328-627 aa of BC038860

  Sequence: LWEKEQEVAALRRSLEQSEAAVAQQDKKQLQEEAARLMRQREELEDKVAACQKEQADFLPRIEETKWEVCQKAGEISLLKQQLKDSQADVSQKLSEIVGLRSQLREGRASLREKEEQLLSLRDSFSSKQASLELGEGELPAACLKPALTPVDPAEPQDALATCESDEAKMRRQAGVAAAASLVYVDGEAEAGGESGTRALRREVGRLQAELAAERRARERQGASFAEERRVWLEEKEKVIEYQKQLQLSYVEMYQRNQQLERRLRERGAAGGASTPTPQHGEEKKAWTPSRLERIESTEI

• Full Name: ProSAPiP1 protein
• Calculated Molecular Weight: 72 kDa
• Observed Molecular Weight: 75 kDa
• GenBank Accession Number: BC038860
• Gene Symbol: ProSAPiP1
• Gene ID (NCBI): 9762
• RRID: AB_2714022
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60299
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB,IP	Neuron; Prosapip1-Dependent Synaptic Adaptations in the Nucleus Accumbens Drive Alcohol Intake, Seeking, and Reward.; Authors - Sophie Laguesse ; KD Validated
	WB	J Neurosci; Nacc1 Mutation in Mice Models Rare Neurodevelopmental Disorder with Underlying Synaptic Dysfunction; Authors - Mark A Deehan