Filter: AllWBIHCIF/ICC

WB analysis using 60092-1-Ig (same clone as 60092-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 60092-1-Ig (Prohibitin antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 60092-1-Ig (same clone as 60092-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 60092-1-Ig (PHB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
WB analysis of HeLa using 60092-1-Ig (same clone as 60092-1-PBS)
HeLa cells were subjected to SDS PAGE followed by western blot with 60092-1-Ig (PHB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
WB analysis of human placenta using 60092-1-Ig (same clone as 60092-1-PBS)
human placenta tissue were subjected to SDS PAGE followed by western blot with 60092-1-Ig (PHB antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60092-1-Ig (Prohibitin antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver tissue slide using 60092-1-Ig (Prohibitin antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60092-1-Ig (Prohibitin Antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart tissue slide using 60092-1-Ig (Prohibitin Antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 60092-1-Ig(PHB antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human heart using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human heart using 60092-1-Ig(PHB antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60092-1-Ig (Prohibitin antibody) at dilution of 1:200 (under 10x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 60092-1-Ig (same clone as 60092-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney tissue slide using 60092-1-Ig (Prohibitin antibody) at dilution of 1:200 (under 40x lens). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.
IF Staining of HeLa using 60092-1-Ig (same clone as 60092-1-PBS)
Immunofluorescent analysis of Hela cells, using PHB antibody 60092-1-Ig at 1:25 dilution and Rhodamine-labeled goat anti-mouse IgG (red). This data was developed using the same antibody clone with 60092-1-PBS in a different storage buffer formulation.

Prohibitin Monoclonal antibody, PBS Only

Prohibitin Monoclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 60092-1-PBS

Clone No.4D3G5

Review Product

Host / Isotype

Mouse / IgG1

Reactivity

human, rat, pig

Applications

WB, IHC, Indirect ELISA

Synonyms

PHB, 4D3G5, PHB1, Prohibitin 1

Formulation: PBS Only

PBS, Azide, Glycerol

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

60092-1-PBS targets Prohibitin in WB, IHC, Indirect ELISA applications and shows reactivity with human, rat, pig samples.

Tested Reactivity	human, rat, pig
Host / Isotype	Mouse / IgG1
Class	Monoclonal
Type	Antibody
Immunogen	CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species
Full Name	prohibitin
Calculated Molecular Weight	30 kDa
Observed Molecular Weight	30 kDa
GenBank Accession Number	BC013401
Gene Symbol	Prohibitin
Gene ID (NCBI)	5245
RRID	AB_2252403
Conjugate	Unconjugated
Form	Liquid
Purification Method	Protein A purification
UNIPROT ID	P35232
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Prohibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).