Tested Applications
| Positive WB detected in | human heart tissue, HeLa cells, human placenta tissue, pig heart tissue, rat heart tissue |
| Positive IHC detected in | human liver tissue, human kidney tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
60092-1-Ig targets Prohibitin in WB, IHC, IF, IP, ELISA applications and shows reactivity with human, rat, pig samples.
| Tested Reactivity | human, rat, pig |
| Cited Reactivity | human, mouse |
| Host / Isotype | Mouse / IgG1 |
| Class | Monoclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag1240 Product name: Recombinant human Prohibitin protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-272 aa of BC013401 Sequence: MAAKVFESIGKFGLALAVAGGVVNSALYNVDAGHRAVIFDRFRGVQDIVVGEGTHFLIPWVQKPIIFDCRSRPRNVPVITGSKDLQNVNITLRILFRPVASQLPRIFTSIGEDYDERVLPSITTEILKSVVARFDAGELITQRELVSRQVSDDLTERAATFGLILDDVSLTHLTFGKEFTEAVEAKQVAQQEAERARFVVEKAEQQKKAAIISAEGDSKAAELIANSLATAGDGLIELRKLEAAEDIAYQLSRSRNITYLPAGQSVLLQLPQ Predict reactive species |
| Full Name | prohibitin |
| Calculated Molecular Weight | 30 kDa |
| Observed Molecular Weight | 30 kDa |
| GenBank Accession Number | BC013401 |
| Gene Symbol | Prohibitin |
| Gene ID (NCBI) | 5245 |
| RRID | AB_2252403 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein G purification |
| UNIPROT ID | P35232 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Prohibitin, also known as PHB, a member of the Band-7 family of proteins, is widely distributed in bacteria, plants, yeast, protozoa and mammals and is important in cell proliferation, differentiation and apoptosis (PMID: 20840588 ). This protein localizes to the inner membrane of mitochondria, where it acts as a chaperone protein, and is also found in the nucleus, where it negatively regulates transcription (PMID: 18558096). Recent study confirmed that the expression and distribution of PHB, which is a nuclear matrix protein, affect the apoptosis of HaCaT cells and its co-localization with specific gene products connected with cell apoptosis (PMID: 24402549).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for Prohibitin antibody 60092-1-Ig | Download protocol |
| IHC protocol for Prohibitin antibody 60092-1-Ig | Download protocol |
| WB protocol for Prohibitin antibody 60092-1-Ig | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The Prohibitin antibody (Cat# 60092-1-Ig) has 5 total citations across journals including International Journal of Biological Sciences, International Journal of Molecular Medicine, International Journal of Chronic Obstructive Pulmonary Disease, Journal of Virology, and Oncotarget. Research fields span colorectal cancer EMT/mitochondrial dynamics, hepatocellular carcinoma autophagy, pulmonary endothelial apoptosis and inflammation, viral replication via RIG-I signaling, and cancer cell migration directionality. Applications include WB, IF, and IP in human and mouse samples.
| Species | Application | Title |
|---|---|---|
Int J Biol Sci PTPLAD1 Regulates PHB-Raf Interaction to Orchestrate Epithelial-Mesenchymal and Mitofusion-Fission Transitions in Colorectal Cancer | ||
Int J Mol Med STOML2 interacts with PHB to activate the MEK/ERK signaling pathway and mediates autophagy‑related proteins in the progression of hepatocellular carcinoma.
| ||
J Virol Prohibitin1 facilitates viral replication by impairing the RIG-I-like receptor signaling pathway | ||
Int J Chron Obstruct Pulmon Dis Prohibitin Protects Pulmonary Microvascular Endothelial Cells Against Cigarette Smoke Extract-Induced Cell Apoptosis and Inflammation. | ||
Oncotarget Prohibitin, relocated to the front ends, can control the migration directionality of colorectal cancer cells. |
