Prosaposin receptor GPR37 Recombinant monoclonal antibody

• Home
• Products
• Primary Antibodies
• Recombinant Antibodies
• Prosaposin receptor GPR37 Recombinant monoclonal antibody (88056-2-RR)

• 

  WB analysis using 88056-2-RR

  Various lysates were subjected to SDS PAGE followed by western blot with 88056-2-RR (Prosaposin receptor GPR37 antibody) at dilution of 1:5000 incubated at room temperature for 1.5 hours.

Prosaposin receptor GPR37 Uni-rAb^® Recombinant Antibody for WB, ELISA

Cat No. 88056-2-RR

Clone No.260192A7

Host / Isotype

Rabbit / IgG

Reactivity

mouse

Applications

WB, ELISA

Synonyms

Gpr37, G-protein coupled receptor 37

---

Tested Applications

• Positive WB detected in: mouse brain tissue, mouse cerebellum tissue

Recommended dilution

• Western Blot (WB): WB : 1:2000-1:10000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

88056-2-RR targets Prosaposin receptor GPR37 in WB, ELISA applications and shows reactivity with mouse samples.

• Tested Reactivity: mouse
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Eg10256

  Product name: Recombinant mouse Prosaposin receptor GPR37 protein

  Source: mammalian cells-derived, V37

  Tag: C-rFc

  Domain: 27-252 aa of NM_010338.2

  Sequence: ALSFVPEPRNGTCLGESCSPLIQRRSRDARGPGNSAKDALRVHVPREKLEAEVRGATSWDLPPPRGGDTGVIEEAAAAGPLGPPTKPPSAWRWKSAQGKEPSGHLRRRDPTDPQLFFPTSEGGEMSSKRDGIPQSRQEHSVKTEPRDLFYWPRRTGQLQDSQHRPSAVHEGRTLAPPGRALPQNGSADDWVPDQGGPRRGNTTRRVRLKNPFYPLTQESYGAYAVM

• Full Name: G protein-coupled receptor 37
• Calculated Molecular Weight: 67 kDa
• Observed Molecular Weight: 50 kDa
• GenBank Accession Number: NM_010338.2
• Gene Symbol: Gpr37
• Gene ID (NCBI): 14763
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q9QY42-1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

G protein-coupled receptor 37 (GPR37), also known as the prosaposin receptor, is a class A GPCR predominantly expressed in the central nervous system, especially in oligodendrocytes and select neuronal populations. GPR37 has been identified as a receptor for prosaposin and prosaptide peptides, mediating neuroprotective and glioprotective signaling. In mice, Gpr37 plays important roles in oligodendrocyte differentiation, myelination, and cellular stress responses, as well as modulation of dopaminergic signaling pathways. Functionally, GPR37 is involved in cell survival, ER stress regulation, and protein quality control, and has been linked to Parkinson's disease-related mechanisms, including its interaction with parkin (PARK2) and propensity to form intracellular aggregates under pathological conditions.