Prostein Recombinant monoclonal antibody, PBS Only (Detector)

Prostein Uni-rAb® Recombinant Antibody for IHC, Cytometric bead array, Indirect ELISA

Cat No. 84629-2-PBS
Clone No.242037G8

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Cytometric bead array, Indirect ELISA

SLC45A3, PCANAP6, Prostate cancer-associated protein 6, PRST

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

84629-2-PBS targets Prostein as part of a matched antibody pair:

MP01440-1: 84629-1-PBS capture and 84629-2-PBS detection (validated in Cytometric bead array)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag5463

Product name: Recombinant human SLC45A3 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 405-553 aa of BC050416

Sequence: REKQVFLPKYRGDTGGASSEDSLMTSFLPGPKPGAPFPNGHVGAGGSGLLPPPPALCGASACDVSVRVVVGEPTEARVVPGRGICLDLAILDSAFLLSQVAPSLFMGSIVQLSQSVTAYMVSAAGLGLVAIYFATQVVFDKSDLAKYSA

Predict reactive species
Full Name solute carrier family 45, member 3
Calculated Molecular Weight 59 kDa
GenBank Accession NumberBC050416
Gene Symbol Prostein
Gene ID (NCBI) 85414
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ96JT2
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

Prostein is a prostate tissue-specific protein whose expression is highly restricted to normal and cancerous prostate tissues. Anti-prostein is useful for the identification of prostate adenocarcinomas and is a good marker to identify prostatic origin in metastatic cancer.

Loading...