Tested Applications
| Positive WB detected in | fetal human brain tissue |
| Positive IHC detected in | human intrahepatic cholangiocarcinoma tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | MCF-7 cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:2000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
28274-1-AP targets RAB17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27206 Product name: Recombinant human RAB17 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 101-212 aa of BC050426 Sequence: TRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCCAH Predict reactive species |
| Full Name | RAB17, member RAS oncogene family |
| Calculated Molecular Weight | 212 aa, 23 kDa |
| Observed Molecular Weight | 23 kDa |
| GenBank Accession Number | BC050426 |
| Gene Symbol | RAB17 |
| Gene ID (NCBI) | 64284 |
| RRID | AB_2881103 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9H0T7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RAB17 is a member of the RAS oncogene family and is classified as a small GTPase that plays a crucial role in intracellular membrane trafficking It is specifically expressed in epithelial cells and is involved in various cellular functions such as transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. This process is mainly observed in epithelial cells and is important for the transcellular transport of substances like immunoglobulins from the basolateral surface to the apical surface. RAB17 is also implicated in the regulation of melanosome transport and release from melanocytes, which is critical for pigmentation in skin cells. Additionally, it has been suggested to regulate dendrite and dendritic spine development, which are important for neuronal function. The protein is involved in membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis.
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB17 antibody 28274-1-AP | Download protocol |
| IHC protocol for RAB17 antibody 28274-1-AP | Download protocol |
| WB protocol for RAB17 antibody 28274-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |







