RAB17 Polyclonal antibody

RAB17 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 28274-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

Ras-related protein Rab-17, Ras related protein Rab 17

Formulation:  PBS and Azide
PBS and Azide
Conjugate:  Unconjugated
Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected infetal human brain tissue
Positive IHC detected inhuman intrahepatic cholangiocarcinoma tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inMCF-7 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:500-1:2000
Immunohistochemistry (IHC)IHC : 1:50-1:500
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

28274-1-AP targets RAB17 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Host / Isotype Rabbit / IgG
Class Polyclonal
Type Antibody
Immunogen

CatNo: Ag27206

Product name: Recombinant human RAB17 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 101-212 aa of BC050426

Sequence: TRKDSFLKAQQWLKDLEEELHPGEVLVMLVGNKTDLSQEREVTFQEGKEFADSQKLLFMETSAKLNHQVSEVFNTVAQELLQRSDEEGQALRGDAAVALNKGPARQAKCCAH

Predict reactive species
Full Name RAB17, member RAS oncogene family
Calculated Molecular Weight 212 aa, 23 kDa
Observed Molecular Weight 23 kDa
GenBank Accession NumberBC050426
Gene Symbol RAB17
Gene ID (NCBI) 64284
RRIDAB_2881103
Conjugate Unconjugated
FormLiquid
Purification MethodAntigen affinity purification
UNIPROT IDQ9H0T7
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAB17 is a member of the RAS oncogene family and is classified as a small GTPase that plays a crucial role in intracellular membrane trafficking It is specifically expressed in epithelial cells and is involved in various cellular functions such as transcytosis, the directed movement of endocytosed material through the cell and its exocytosis from the plasma membrane at the opposite side. This process is mainly observed in epithelial cells and is important for the transcellular transport of substances like immunoglobulins from the basolateral surface to the apical surface. RAB17 is also implicated in the regulation of melanosome transport and release from melanocytes, which is critical for pigmentation in skin cells. Additionally, it has been suggested to regulate dendrite and dendritic spine development, which are important for neuronal function. The protein is involved in membrane trafficking through apical recycling endosomes in a post-endocytic step of transcytosis.

Protocols

Product Specific Protocols
WB protocol for RAB17 antibody 28274-1-APDownload protocol
IHC protocol for RAB17 antibody 28274-1-APDownload protocol
IF protocol for RAB17 antibody 28274-1-APDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...