RAB32 Recombinant monoclonal antibody, PBS Only (Detector)

• 

  Sandwich ELISA standard curve of MP00043-2

  Sandwich ELISA standard curve of MP00043-2, Human RAB32 Recombinant Matched Antibody Pair - PBS only. 82960-3-PBS was coated to a plate as the capture antibody and incubated with serial dilutions of standard Ag1450. 82960-4-PBS was HRP conjugated as the detection antibody. Range: 0.156-10 ng/mL.

• 

  Sample test of MP00043-2

  The mean RAB32 concentration was determined to be 2.03 ng/mL in K-562 cell extract based on a 4.50 mg/mL extract load.

• 

  Cytometric bead array standard curve of MP00043-2

  Cytometric bead array standard curve of MP00043-2, RAB32 Recombinant Matched Antibody Pair, PBS Only. Capture antibody: 82960-3-PBS. Detection antibody: 82960-4-PBS. Standard: Ag1450. Range: 1.25-20 ng/mL.

• 

  Affinity and Kinetic Characterization of 82960-4-PBS

  Biolayer interferometry (BLl) kinetic assay of 82960-4-PBS against Human RAB32 was performed. The affinity constant is 39.4 pM.

RAB32 Uni-rAb^® Recombinant Antibody for Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Cat No. 82960-4-PBS

Clone No.230315F1

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

Cytometric bead array, Sandwich ELISA, Indirect ELISA, Sample test

Synonyms

Ras related protein Rab 32, Ras-related protein Rab-32

---

Product Information

82960-4-PBS targets RAB32 as part of a matched antibody pair:

MP00043-2: 82960-3-PBS capture and 82960-4-PBS detection (validated in Cytometric bead array, Sandwich ELISA)

Unconjugated rabbit recombinant monoclonal antibody in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation. Created using Proteintech’s proprietary in-house recombinant technology. Recombinant production enables unrivalled batch-to-batch consistency, easy scale-up, and future security of supply.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Recombinant
• Type: Antibody
• Immunogen:

  CatNo: Ag1450

  Product name: Recombinant human RAB32 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-225 aa of BC015061

  Sequence: MAGGGAGDPGLGAAAAPAPETREHLFKVLVIGELGVGKTSIIKRYVHQLFSQHYRATIGVDFALKVLNWDSRTLVRLQLWDIAGQERFGNMTRVYYKEAVGAFVVFDISRSSTFEAVLKWKSDLDSKVHLPNGSPIPAVLLANKCDQNKDSSQSPSQVDQFCKEHGFAGWFETSAKDNINIEEAARFLVEKILVNHQSFPNEENDVDKIKLDQETLRAENKSQCC

• Full Name: RAB32, member RAS oncogene family
• Calculated Molecular Weight: 25 kDa
• GenBank Accession Number: BC015061
• Gene Symbol: RAB32
• Gene ID (NCBI): 10981
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein A purification
• UNIPROT ID: Q13637
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.