Tested Applications
| Positive WB detected in | HeLa cells, human brain tissue, mouse brain tissue, rat brain tissue |
| Positive IP detected in | mouse brain tissue |
| Positive IHC detected in | human gliomas tissue, mouse brain tissue, human pancreas tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF-P detected in | mouse brain tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunoprecipitation (IP) | IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)-P | IF-P : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
11947-1-AP targets RAB5A in WB, IHC, IF-P, IP, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse, rat, pig, monkey, zebrafish |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2549 Product name: Recombinant human RAB5A protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-215 aa of BC001267 Sequence: MASRGATRPNGPNTGNKICQFKLVLLGESAVGKSSLVLRFVKGQFHEFQESTIGAAFLTQTVCLDDTTVKFEIWDTAGQERYHSLAPMYYRGAQAAIVVYDITNEESFARAKNWVKELQRQASPNIVIALSGNKADLANKRAVDFQEAQSYADDNSLLFMETSAKTSMNVNEIFMAIAKKLPKNEPQNPGANSARGRGVDLTEPTQPTRNQCCSN Predict reactive species |
| Full Name | RAB5A, member RAS oncogene family |
| Calculated Molecular Weight | 215 aa, 24 kDa |
| Observed Molecular Weight | 24 kDa |
| GenBank Accession Number | BC001267 |
| Gene Symbol | RAB5A |
| Gene ID (NCBI) | 5868 |
| RRID | AB_2269388 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P20339 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RAB5A antibody 11947-1-AP | Download protocol |
| IHC protocol for RAB5A antibody 11947-1-AP | Download protocol |
| IP protocol for RAB5A antibody 11947-1-AP | Download protocol |
| WB protocol for RAB5A antibody 11947-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
Anti-Rab5a antibody (Cat# 11947-1-AP) has accumulated 57 citations published in 48 journals, including high-impact venues such as Cell Metabolism, Immunity, Nature Genetics, Nature Communications, Cell Reports, Development, eLife, and Current Biology. Associated research fields encompass endosomal trafficking, autophagy and mitophagy, cancer biology (breast, ovarian, pancreatic, glioma), viral infections, neurodegeneration, diabetes, lipid metabolism, ferroptosis, immune responses, and cardiovascular disease.
| Species | Application | Title |
|---|---|---|
Cell Metab Sensing steroid hormone 17α-hydroxypregnenolone by GPR56 enables protection from ferroptosis-induced liver injury | ||
Cell Metab Hepatic lipid remodeling in cold exposure uncovers direct regulation of bis(monoacylglycero)phosphate lipids by phospholipase A2 group XV | ||
Immunity Targeting intracellular oncoproteins with dimeric IgA promotes expulsion from the cytoplasm and immune-mediated control of epithelial cancers | ||
Immunity trans-Endothelial neutrophil migration activates bactericidal function via Piezo1 mechanosensing | ||
Autophagy Live imaging of intra-lysosome pH in cell lines and primary neuronal culture using a novel genetically encoded biosensor. |
Reviews
What customers say
Most reviewers report good to very strong Western Blot performance, with one user highlighting a high titer at 25 kD and another confirming reliable signal in HEK293T cells. Immunofluorescence results were generally positive, though one user noted strong background when staining primary mouse neurons. A couple of reviewers found the WB signal weaker than expected, though still usable. Overall, the antibody is well-regarded for WB across multiple cell types and tissues, with dilutions ranging from 1:500 to 1:4000 depending on the application.
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
Baptiste (Verified Customer) (06-08-2026) | Good signal but strong background.
|
Sophy (Verified Customer) (02-27-2023) | The antibody was used at 1:1000 for western blot. The signal showed up but not as strong as expected. But since this was the only antibody purchased for Rab5A, I had no comparison to antibodies to other vendors.
|
Xin (Verified Customer) (01-24-2022) | Very good antibody in WB (25 kD) with a high titer
|
Tom (Verified Customer) (11-13-2020) | HEK293T cell extracts (10ug/lane). Primary antibody (1:2000) in block (5% BSA) incubated at 4 degrees overnight. Goat anti-rabbit HRP secondary antibody (1:10,000) incubated for 1 hour at RT.
 |
Aamir (Verified Customer) (01-19-2020) | Used in HEK cells. Good signal for WB and IF
|
