RAB5C Polyclonal antibody

• 

  WB analysis of A549 using 27219-1-AP

  A549 cells were subjected to SDS PAGE followed by western blot with 27219-1-AP (RAB5C antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of U-937 using 27219-1-AP

  U-937 cells were subjected to SDS PAGE followed by western blot with 27219-1-AP (RAB5C antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

RAB5C Polyclonal Antibody for WB, ELISA

Cat No. 27219-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

L1880, RAB5C, RAB5CL, RAB5L, RABL, Ras related protein Rab 5C

---

Tested Applications

• Positive WB detected in: A549 cells, U-937 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below

Product Information

27219-1-AP targets RAB5C in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25849

  Product name: Recombinant human RAB5C protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 138-216 aa of BC106039

  Sequence: LASKRAVEFQEAQAYADDNSLLFMETSAKTAMNVNEIFMAIAKKLPKNEPQNATGAPGRNRGVDLQENNPASRSQCCSN

• Full Name: RAB5C, member RAS oncogene family
• Calculated Molecular Weight: 216 aa, 23 kDa
• Observed Molecular Weight: 23 kDa
• GenBank Accession Number: BC106039
• Gene Symbol: RAB5C
• Gene ID (NCBI): 5878
• RRID: AB_2880806
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P51148
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Front Immunol; Novel Host Protein TBC1D16, a GTPase Activating Protein of Rab5C, Inhibits Prototype Foamy Virus Replication.; Authors - Jun Yan