Rac1 Polyclonal antibody

• 

  WB analysis using 24072-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 24072-1-AP (Rac1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 24072-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 24072-1-AP (RAC1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of human brain using 24072-1-AP

  human brain tissue were subjected to SDS PAGE followed by western blot with 24072-1-AP (RAC1 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 24072-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24072-1-AP (Rac1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 24072-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 24072-1-AP (Rac1 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse brain using 24072-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 24072-1-AP (Rac1 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of HeLa using 24072-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 24072-1-AP (Rac1 antibody), at dilution of 1:200 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

Rac1 Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 24072-1-AP

Publications(112)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat and More (2)

Applications

WB, IHC, IF/ICC, IP, CoIP, ELISA

Synonyms

MIG5, Cell migration-inducing gene 5 protein, EC:3.6.5.2, p21 Rac1, p21-Rac1

---

Tested Applications

• Positive WB detected in: mouse brain tissue, human brain tissue, rat brain tissue
• Positive IHC detected in: human lung cancer tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:500
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 6 publications below
• WB: See 102 publications below
• IHC: See 12 publications below
• IF: See 15 publications below
• IP: See 3 publications below
• CoIP: See 4 publications below

Product Information

24072-1-AP targets Rac1 in WB, IHC, IF/ICC, IP, CoIP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human, mouse, rat, chicken, hamster
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag17779

  Product name: Recombinant human RAC1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 1-192 aa of BC004247

  Sequence: MQAIKCVVVGDGAVGKTCLLISYTTNAFPGEYIPTVFDNYSANVMVDGKPVNLGLWDTAGQEDYDRLRPLSYPQTDVFLICFSLVSPASFENVRAKWYPEVRHHCPNTPIILVGTKLDLRDDKDTIEKLKEKKLIPITYPQGLAMAKEIGAVKYLECSALTQRGLKTVFDEAIRAVLCPPPVKKRKRKCLLL

• Full Name: ras-related C3 botulinum toxin substrate 1 (rho family, small GTP binding protein Rac1)
• Calculated Molecular Weight: 21 kDa
• Observed Molecular Weight: 21 kDa
• GenBank Accession Number: BC004247
• Gene Symbol: RAC1
• Gene ID (NCBI): 5879
• RRID: AB_2879427
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P63000
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RAC1b, also named as TC25, belongs to the small GTPase superfamily and Rho family. RAC1 is a plasma membrane-associated small GTPase which cycles between active GTP-bound and inactive GDP-bound states. In its active state, it binds to a variety of effector proteins to regulate cellular responses such as secretory processes, phagocytosis of apoptotic cells, epithelial cell polarization and growth-factor induced formation of membrane ruffles.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Cell Death Differ; Thymic egress and peripheral T cell homeostasis regulated by Rho GTPase-activating protein 30; Authors - Huiling Zhang
human	WB	Nat Commun; Regulation of local GTP availability controls RAC1 activity and cell invasion; Authors - Anna Bianchi-Smiraglia
rat	WB,coIP	ACS Nano; Oxidation of Reduced Graphene Oxide via Cellular Redox Signaling Modulates Actin-Mediated Neurotransmission.; Authors - Yiyuan Kang
mouse,human	WB,IHC	Cancer Res; CSTF2-induced shortening of the RAC1 3'UTR promotes the pathogenesis of urothelial carcinoma of the bladder.; Authors - Xin Chen
		Nucleic Acids Res; DOCK7 protects against replication stress by promoting RPA stability on chromatin.; Authors - Ming Gao
mouse	WB	Biomaterials; Three-dimensional cell-culture platform based on hydrogel with tunable microenvironmental properties to improve insulin-secreting function of MIN6 cells.; Authors - Miao Zhang