Product Information
84994-1-PBS targets RAF1 in Indirect ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Recombinant |
| Type | Antibody |
| Immunogen |
CatNo: Ag25423 Product name: Recombinant human RAF1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-59 aa of BC018119 Sequence: MEHIQGAWKTISNGFGFKDAVFDGSSCISPTIVQQFGYQRRASDDGKLTDPSKTSNTIR Predict reactive species |
| Full Name | v-raf-1 murine leukemia viral oncogene homolog 1 |
| Calculated Molecular Weight | 648 aa, 73 kDa |
| GenBank Accession Number | BC018119 |
| Gene Symbol | RAF1 |
| Gene ID (NCBI) | 5894 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Protein A purification |
| UNIPROT ID | P04049 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
