RALBP1 Polyclonal antibody

• 

  WB analysis of K-562 using 13176-1-AP

  K-562 cells were subjected to SDS PAGE followed by western blot with 13176-1-AP (RALBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HepG2 using 13176-1-AP

  HepG2 cells were subjected to SDS PAGE followed by western blot with 13176-1-AP (RALBP1 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of MCF-7 using 13176-1-AP

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 13176-1-AP (RALBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HEK-293 using 13176-1-AP

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 13176-1-AP (RALBP1 Antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of K-562 using 13176-1-AP

  IP result of anti-RALBP1 (IP:13176-1-AP, 4ug; Detection:13176-1-AP 1:800) with K-562 cells lysate 3600ug.

• 

  IHC staining of human stomach using 13176-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 13176-1-AP (RALBP1 antibody) at dilution of 1:200 (under 20x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RALBP1 Polyclonal Antibody for WB, IHC, IP, ELISA

Cat No. 13176-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IHC, IP, ELISA

Synonyms

EC:7.6.2.2, EC:7.6.2.3, DNP-SG ATPase, DNP SG ATPase, Dinitrophenyl S-glutathione ATPase, 76 kDa Ral-interacting protein

---

Tested Applications

• Positive WB detected in: K-562 cells, HEK-293 cells, HepG2 cells, MCF-7 cells
• Positive IP detected in: K-562 cells
• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 2 publications below
• IHC: See 1 publications below

Product Information

13176-1-AP targets RALBP1 in WB, IHC, IP, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3843

  Product name: Recombinant human RALBP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-351 aa of BC013126

  Sequence: MTECFLPPTSSPSEHRRVEHGSGLTRTPSSEEISPTKFPGLYRTGEPSPPHDILHEPPDVVSDDEKDHGKKKGKFKKKEKRTEGYAAFQEDSSGDEAESPSKMKRSKGIHVFKKPSFSKKKEKDFKIKEKPKEEKHKEEKHKEEKHKEKKSKDLTAADVVKQWKEKKKKKKPIQEPEVPQIDVPNLKPIFGIPLADAVERTMMYDGIRLPAVFRECIDYVEKYGMKCEGIYRVSGIKSKVDELKAAYDREESTNLEDYEPNTVASLLKQYLRDLPENLLTKELMPRFEEACGRTTETEKVQEFQRLLKELPECNYLLISWLIVHMDHVIAKELETKMNIQNISIVLSPTVQ

• Full Name: ralA binding protein 1
• Calculated Molecular Weight: 655 aa, 76 kDa
• Observed Molecular Weight: 95 kDa
• GenBank Accession Number: BC013126
• Gene Symbol: RALBP1
• Gene ID (NCBI): 10928
• RRID: AB_2176171
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q15311
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB,IHC	Neoplasia; PMID: 28092822; Authors - Jian Yang
mouse	WB	Sci Rep; Mitigating effects of Jiawei Chaihu Shugan decoction on necroptosis and inflammation of hippocampal neurons in epileptic mice; Authors - Qin Wang