RAMP2 Polyclonal antibody, PBS Only

• 

  WB analysis of mouse brain using 13223-2-AP (same clone as 13223-2-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 13223-2-AP (RAMP2 antibody) at dilution of 1:400 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 13223-2-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 13223-2-AP (same clone as 13223-2-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 13223-2-AP (RAMP2 antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 13223-2-PBS in a different storage buffer formulation.

RAMP2 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 13223-2-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

13223-2-PBS targets RAMP2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag4028

  Product name: Recombinant human RAMP2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC027975

  Sequence: MASLRVERAGGPRLPRTRVGRPAALRLLLLLGAVLNPHEALAQPLPTTGTPGSEGGTVKNYETAVQFCWNHYKDQMDPIEKDWCDWAMISRPYSTLRDCLEHFAELFDLGFPNPLAERIIFETHQIHFANCSLVQPTFSDPPEDVLLA

• Full Name: receptor (G protein-coupled) activity modifying protein 2
• Calculated Molecular Weight: 175 aa, 20 kDa
• Observed Molecular Weight: 20 kDa
• GenBank Accession Number: BC027975
• Gene Symbol: RAMP2
• Gene ID (NCBI): 10266
• RRID: AB_2176337
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60895
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RAMP2 (receptor-activity-modifying protein) is a member of the RAMP family of single-transmembrane-domain proteins which consist of an N-terminal extracellular domain, a transmembrane region and a short intracellular C-terminal tail. RAMPs are required to transport calcitonin-receptor-like receptor (CRLR) to the plasma membrane. CRLR, a G protein-coupled receptor, can function as either a calcitonin gene-related peptide (CGRP) receptor or an adrenomedullin receptor, depending on which members of the RAMP family are expressed. RAMP1 transports the CRLR to the plasma membrane and then remains associated with it to function as a terminally glycosylated CGRP receptor, while RAMP2 and RAMP3 transfer the CRLR to the cell surface to generate receptors that are preferentially selective for adrenomedullin. (PMID: 9620797; 16188935)