RAMP3 Polyclonal antibody, PBS Only

• 

  WB analysis using 11861-1-AP (same clone as 11861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11861-1-AP (same clone as 11861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human kidney using 11861-1-AP (same clone as 11861-1-PBS)

  human kidney tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 11861-1-AP (same clone as 11861-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:0 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse brain using 11861-1-AP (same clone as 11861-1-PBS)

  mouse brain tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse skeletal muscle using 11861-1-AP (same clone as 11861-1-PBS)

  mouse skeletal muscle tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse heart using 11861-1-AP (same clone as 11861-1-PBS)

  mouse heart tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of mouse pancreas using 11861-1-AP (same clone as 11861-1-PBS)

  mouse pancreas tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human placenta using 11861-1-AP (same clone as 11861-1-PBS)

  human placenta tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis of human heart using 11861-1-AP (same clone as 11861-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 11861-1-AP (same clone as 11861-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human breast cancer using 11861-1-AP (same clone as 11861-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11861-1-AP (RAMP3 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 11861-1-PBS in a different storage buffer formulation.

RAMP3 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 11861-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

11861-1-PBS targets RAMP3 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2438

  Product name: Recombinant human RAMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC022304

  Sequence: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

• Full Name: receptor (G protein-coupled) activity modifying protein 3
• Calculated Molecular Weight: 16.5 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC022304
• Gene Symbol: RAMP3
• Gene ID (NCBI): 10268
• RRID: AB_2176465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60896
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated 58-kD CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors.