RAMP3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RAMP3 Polyclonal antibody (11861-1-AP)

RAMP3 Polyclonal Antibody for WB, IHC, FC (Intra), ELISA

Cat No. 11861-1-AP

Publications(1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IHC, FC (Intra), ELISA

Synonyms

Calcitonin-receptor-like receptor activity-modifying protein 3, CRLR activity-modifying protein 3, Receptor activity-modifying protein 3

• 

  WB analysis using 11861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  WB analysis using 11861-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 11861-1-AP (RAMP3 antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human breast cancer using 11861-1-AP

  Immunohistochemical analysis of paraffin-embedded human breast cancer using 11861-1-AP (RAMP3 antibody) at dilution of 1:50 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  FC experiment of Jurkat using 11861-1-AP

  1x10^6 Jurkat cells were intracellularly stained with 0.25 ug RAMP3 Polyclonal antibody (11861-1-AP) and CoraLite®488-Conjugated Goat Anti-Rabbit IgG(H+L) (SA00013-2)(red), or 0.25 ug Isotype Control (blue). Cells were fixed with 4% PFA and permeabilized with Flow Cytometry Perm Buffer.

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

---

Tested Applications

• Positive WB detected in: A549 cells, mouse lung tissue, MCF-7 cells
• Positive IHC detected in: human breast cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive FC (Intra) detected in: Jurkat cells

Recommended dilution

• Western Blot (WB): WB : 1:200-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200
• Flow Cytometry (FC) (INTRA): FC (INTRA) : 0.25 ug per 10^6 cells in a 100 µl suspension

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

11861-1-AP targets RAMP3 in WB, IHC, FC (Intra), ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2438

  Product name: Recombinant human RAMP3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-148 aa of BC022304

  Sequence: METGALRRPQLLPLLLLLCGGCPRAGGCNETGMLERLPLCGKAFADMMGKVDVWKWCNLSEFIVYYESFTNCTEMEANVVGCYWPNPLAQGFITGIHRQFFSNCTVDRVHLEDPPDEVLIPLIVIPVVLTVAMAGLVVWRSKRTDTLL

• Full Name: receptor (G protein-coupled) activity modifying protein 3
• Calculated Molecular Weight: 16.5 kDa
• Observed Molecular Weight: 45-50 kDa
• GenBank Accession Number: BC022304
• Gene Symbol: RAMP3
• Gene ID (NCBI): 10268
• RRID: AB_2176465
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O60896
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

The receptor activity-modifying proteins (RAMPs) and the calcitonin receptor-like receptor (CRLR) are both required to generate adrenomedullin (AM) and calcitonin gene-related peptide (CGRP) receptors. During the process, RAMP3 transports the glycosylated CGRPR to the cell surface. The formation of CRLR-RAMP heterodimer is essential for the proper cell surface targeting and pharmacological characteristics of both CGRP and AM receptors. RAMP3 exists in different molecular weight forms: 19 kDa monomer, 35-40 kDa monomer heteroglycosylation, 50 kDa homodimer, and 73 kDa heterodimer (PMID: 19546305).

Publications

What published studies show

Automatically generated from the publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IHC	J Chin Med Assoc; WGCNA reveals a biomarker for cancer-associated fibroblasts to predict prognosis in cervical cancer; Authors - Zao-Ling Liu