RanGAP1 Monoclonal antibody, PBS Only (Capture)

RanGAP1 Monoclonal Antibody for WB, IF/ICC, Cytometric bead array, Indirect ELISA

Cat No. 67146-1-PBS
Clone No.1F3A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, Cytometric bead array, Indirect ELISA

1F3A4, KIAA1835, Ran GTPase-activating protein 1, SD

Formulation:  PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

67146-1-PBS targets RanGAP1 as part of a matched antibody pair:

MP51544-1: 67146-1-PBS capture and 67146-2-PBS detection (validated in Cytometric bead array)

Unconjugated mouse monoclonal antibody pair in PBS only (BSA and azide free) storage buffer at a concentration of 1 mg/mL, ready for conjugation.

This conjugation ready format makes antibodies ideal for use in many applications including: ELISAs, multiplex assays requiring matched pairs, mass cytometry, and multiplex imaging applications.Antibody use should be optimized by the end user for each application and assay.

Tested Reactivity human, mouse, rat
Host / Isotype Mouse / IgG1
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag26136

Product name: Recombinant human RANGAP1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 2-220 aa of BC014044

Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI

Predict reactive species
Full Name Ran GTPase activating protein 1
Calculated Molecular Weight 64 kDa
Observed Molecular Weight 64 kDa, 82 kDa
GenBank Accession NumberBC014044
Gene Symbol RANGAP1
Gene ID (NCBI) 5905
RRIDAB_2882445
Conjugate Unconjugated
FormLiquid
Purification MethodProtein G purification
UNIPROT IDP46060
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.

Loading...
||
New chat

Able

正在加载,请稍候...