RanGAP1 Monoclonal antibody, PBS Only

• 

  WB analysis of HeLa using 67146-1-Ig (same clone as 67146-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 67146-1-Ig (same clone as 67146-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HEK-293 using 67146-1-Ig (same clone as 67146-1-PBS)

  HEK-293 cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of MCF-7 using 67146-1-Ig (same clone as 67146-1-PBS)

  MCF-7 cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Jurkat using 67146-1-Ig (same clone as 67146-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HSC-T6 using 67146-1-Ig (same clone as 67146-1-PBS)

  HSC-T6 cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of NIH/3T3 using 67146-1-Ig (same clone as 67146-1-PBS)

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  WB analysis of 4T1 using 67146-1-Ig (same clone as 67146-1-PBS)

  4T1 cells were subjected to SDS PAGE followed by western blot with 67146-1-Ig (RANGAP1 antibody) at dilution of 1:10000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HepG2 using 67146-1-Ig (same clone as 67146-1-PBS)

  Immunofluorescent analysis of (4% PFA) fixed HepG2 cells using 67146-1-Ig (RANGAP1 antibody) at dilution of 1:100 and CoraLite488-Conjugated AffiniPure Goat Anti-Mouse IgG(H+L). This data was developed using the same antibody clone with 67146-1-PBS in a different storage buffer formulation.

RanGAP1 Monoclonal Antibody for WB, IF/ICC, ELISA

Cat No. 67146-1-PBS

Clone No.1F3A4

Host / Isotype

Mouse / IgG1

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

1F3A4, KIAA1835, Ran GTPase-activating protein 1, SD

---

Product Information

67146-1-PBS targets RanGAP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Mouse / IgG1
• Class: Monoclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag26136

  Product name: Recombinant human RANGAP1 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 2-220 aa of BC014044

  Sequence: ASEDIAKLAETLAKTQVAGGQLSFKGKSLKLNTAEDAKDVIKEIEDFDSLEALRLEGNTVGVEAARVIAKALEKKSELKRCHWSDMFTGRLRTEIPPALISLGEGLITAGAQLVELDLSDNAFGPDGVQGFEALLKSSACFTLQELKLNNCGMGIGGGKILAAALTECHRKSSAQGKPLALKVFVAGRNRLENDGATALAEAFRVIGTLEEVHMPQNGI

• Full Name: Ran GTPase activating protein 1
• Calculated Molecular Weight: 64 kDa
• Observed Molecular Weight: 64 kDa, 82 kDa
• GenBank Accession Number: BC014044
• Gene Symbol: RANGAP1
• Gene ID (NCBI): 5905
• RRID: AB_2882445
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Protein G purification
• UNIPROT ID: P46060
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RanGAP1 is a protein that associates with the nuclear pore complex and participates in the regulation of nuclear transport. In mammalian cells, unmodified RanGAP1 is predominantly cytoplasmic, whereas modification by small ubiquitin-related modifier protein (SUMO) targets RanGAP1 to the cytoplasmic filaments of nuclear pore complex (NPC) where it forms a complex with RanBP2 and Ubc9. Phosphorylation of RanGAP1 occurs in a cell-cycle-dependent manner and may play a role in regulating RanGAP1 catalytic activity. We got 64 kDa (cytoplasmic Ran GAP1) and 82 kDa (SUMO-1 modified Ran GAP1) in western blotting.