RARRES3 Polyclonal antibody

• 

  IHC staining of human lung cancer using 12065-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12065-1-AP (RARRES3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 12065-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12065-1-AP (RARRES3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• Featured Product
• KD/KO Validated

RARRES3 Polyclonal Antibody for IHC, ELISA

Cat No. 12065-1-AP

Publications(3)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, IHC, ELISA

Synonyms

HRASLS4, PLA1/2 3, RAR responsive protein TIG3, RARRES3, RIG1, TIG3

---

Tested Applications

• Positive IHC detected in: human lung cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 3 publications below

Product Information

12065-1-AP targets RARRES3 in WB, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2702

  Product name: Recombinant human RARRES3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC009678

  Sequence: MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA

• Full Name: retinoic acid receptor responder (tazarotene induced) 3
• Calculated Molecular Weight: 164 aa, 18 kDa
• GenBank Accession Number: BC009678
• Gene Symbol: RARRES3
• Gene ID (NCBI): 5920
• RRID: AB_2175704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL19
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Nat Microbiol; PMID: 30988429; Authors - Daisuke Yamane
human	WB	Heliyon; Phospholipase A/acyltransferase 4 is a prognostic biomarker and correlated with immune infiltrates in pancreatic cancer; Authors - Tian-Hao Li ; KD Validated
human	WB	Cell; Human IRF1 governs macrophagic IFN-γ immunity to mycobacteria; Authors - Jérémie Rosain

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Will (Verified Customer) (01-31-2019)

good antibody, would use again

• Applications: Western Blot,