RARRES3 Polyclonal antibody, PBS Only

• 

  IHC staining of human lung cancer using 12065-1-AP (same clone as 12065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12065-1-AP (RARRES3 antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12065-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human lung cancer using 12065-1-AP (same clone as 12065-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 12065-1-AP (RARRES3 antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12065-1-PBS in a different storage buffer formulation.

• Featured Product
• KD/KO Validated

RARRES3 Polyclonal Antibody for IHC, Indirect ELISA

Cat No. 12065-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IHC, Indirect ELISA

Synonyms

---

Product Information

12065-1-PBS targets RARRES3 in IHC, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2702

  Product name: Recombinant human RARRES3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-164 aa of BC009678

  Sequence: MASPHQEPKPGDLIEIFRLGYEHWALYIGDGYVIHLAPPSEYPGAGSSSVFSVLSNSAEVKRERLEDVVGGCCYRVNNSLDHEYQPRPVEVIISSAKEMVGQKMKYSIVSRNCEHFVTQLRYGKSRCKQVEKAKVEVGVATALGILVVAGCSFAIRRYQKKATA

• Full Name: retinoic acid receptor responder (tazarotene induced) 3
• Calculated Molecular Weight: 164 aa, 18 kDa
• GenBank Accession Number: BC009678
• Gene Symbol: RARRES3
• Gene ID (NCBI): 5920
• RRID: AB_2175704
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UL19
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.