RASGRP1 Polyclonal antibody

• 

  WB analysis using 26997-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 26997-1-AP (RASGRP1 antibody) at dilution of 1:2500 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HepG2 using 26997-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HepG2 cells using RASGRP1 antibody (26997-1-AP) at dilution of 1:400 and CoraLite®488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L) (SA00013-2), CL594-phalloidin (red).

RASGRP1 Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 26997-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, ELISA

Synonyms

Ras guanyl releasing protein, hRasGRP1, CalDAG-GEFII, CALDAG GEFII, CALDAG GEFI

---

Tested Applications

• Positive WB detected in: mouse brain tissue, rat brain tissue
• Positive IF/ICC detected in: HepG2 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:5000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:200-1:800

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26997-1-AP targets RASGRP1 in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25725

  Product name: Recombinant human RASGRP1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 678-797 aa of BC109297

  Sequence: QPWIGSEGPSGPFVLSSPRKTAQDTLYVLPSPTSPCPSPVLVRKRAFVKWENKDSLIKSKEELRHLRLPTYQELEQEINTLKADNDALKIQLKYAQKKIESLQLEKSNHVLAQMEQGDCS

• Full Name: RAS guanyl releasing protein 1 (calcium and DAG-regulated)
• Calculated Molecular Weight: 797 aa, 90 kDa
• Observed Molecular Weight: 85-90 kDa
• GenBank Accession Number: BC109297
• Gene Symbol: RASGRP1
• Gene ID (NCBI): 10125
• RRID: AB_3669579
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O95267
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RASGRP1 (RAS guanyl-releasing protein 1) is a Ras guanine nucleotide exchange factor, and an essential regulator of lymphocyte receptor signaling (PMID: 33065764). RasGRP1 is a bifunctional regulator that promotes acute inflammation and inhibits inflammation-associated cancer (PMID: 36385095). RasGRP1, a downstream target gene of VEGF, regulates the development, homeostasis, and differentiation of T cells (PMID: 37429143).