• Featured Product
  • KD/KO Validated

RB1 Monoclonal antibody

RB1 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67521-1-Ig
Clone No.1A2A6

Host / Isotype

Mouse / IgG2a

Reactivity

human

Applications

WB, IHC, IF/ICC, ELISA

pRb, pp110, p110-RB1 , p110-RB1, p105-Rb

Formulation:  PBS, Azide, Glycerol
PBS, Azide, Glycerol
PBS Only
Conjugate:  Unconjugated
Unconjugated
CoraLite® Plus 488
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inJurkat cells, HL-60 cells, K-562 cells, MCF-7 cells, TF-1 cells
Positive IHC detected inInsulinoma tissue, rat eye tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inSH-SY5Y cells, U2OS cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:1000-1:6000
Immunohistochemistry (IHC)IHC : 1:500-1:2000
Immunofluorescence (IF)/ICCIF/ICC : 1:200-1:800
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67521-1-Ig targets RB1 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with human samples.

Tested Reactivity human
Cited Reactivityhuman
Host / Isotype Mouse / IgG2a
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag22578

Product name: Recombinant human RB1 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 373-581 aa of BC039060

Sequence: TPVRTVMNTIQQLMMILNSASDQPSENLISYFNNCTVNPKESILKRVKDIGYIFKEKFAKAVGQGCVEIGSQRYKLGVRLYYRVMESMLKSEEERLSIQNFSKLLNDNIFHMSLLACALEVVMATYSRSTSQNLDSGTDLSFPWILNVLNLKAFDFYKVIESFIKAEGNLTREMIKHLERCEHRIMESLAWLSDSPLFDLIKQSKDREG

Predict reactive species
Full Name retinoblastoma 1
Calculated Molecular Weight 928 aa, 106 kDa
Observed Molecular Weight 110 kDa
GenBank Accession NumberBC039060
Gene Symbol RB1
Gene ID (NCBI) 5925
RRIDAB_2882741
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDP06400
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RB1, also named as pp110, pRb and p105 Rb, belongs to the retinoblastoma protein (RB) family. It is a key regulator of entry into cell division that acts as a tumor suppressor. RB1 acts as a transcription repressor of E2F1 target genes. The underphosphorylated, active form of RB1 interacts with E2F1 and represses its transcription activity, leading to cell cycle arrest. It is directly involved in heterochromatin formation by maintaining overall chromatin structure and, in particular, that of constitutive heterochromatin by stabilizing histone methylation. It recruits and targets histone methyltransferases SUV39H1, SUV420H1 and SUV420H2, leading to epigenetic transcriptional repression. RB1 controls histone H4 'Lys-20' trimethylation and inhibits the intrinsic kinase activity of TAF1. It mediates transcriptional repression by SMARCA4/BRG1 by recruiting a histone deacetylase (HDAC) complex to the c-FOS promoter. In resting neurons, transcription of the c-FOS promoter is inhibited by BRG1-dependent recruitment of a phospho-RB1-HDAC1 repressor complex. Upon calcium influx, RB1 is dephosphorylated by calcineurin, which leads to release of the repressor complex. In case of viral infections, interactions with SV40 large T antigen, HPV E7 protein or adenovirus E1A protein induce the disassembly of RB1-E2F1 complex thereby disrupting RB1's activity.

Protocols

Product Specific Protocols
IF protocol for RB1 antibody 67521-1-IgDownload protocol
IHC protocol for RB1 antibody 67521-1-IgDownload protocol
WB protocol for RB1 antibody 67521-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols

Publications

SpeciesApplicationTitle
humanWB

Adv Sci (Weinh)

Positive Feedback Regulation between KLF5 and XPO1 Promotes Cell Cycle Progression of Basal like Breast Cancer

Authors - Yu Tang
humanWB

Environ Toxicol

RB1 Mutations Induce Smoking-Related Bladder Cancer by Modulating the Cytochrome P450 Pathway

Authors - Zhenguang Mao
  • KD Validated
humanWB

Cancer Res

CDK4/6 Alters TBK1 Phosphorylation to Inhibit the STING Signaling Pathway in Prostate Cancer

Authors - Wei Li
humanWB

Life (Basel)

Investigating the Effects of Chelidonic Acid on Oxidative Stress-Induced Premature Cellular Senescence in Human Skin Fibroblast Cells

Authors - Burcu Turkoglu
Loading...
||
New chat Able
正在加载,请稍候...