RBBP6 Recombinant monoclonal antibody, PBS Only

RBBP6 Uni-rAb® Recombinant Antibody for WB, IF/ICC, Indirect ELISA

Cat No. 85884-5-PBS
Clone No.250142C1

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, Indirect ELISA

E3 ubiquitin-protein ligase RBBP6, EC:2.3.2.27, MY038, P2P R, P2PR

Formulation:  PBS Only
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Product Information

85884-5-PBS targets RBBP6 in WB, IF/ICC, Indirect ELISA applications and shows reactivity with human, mouse samples.

Tested Reactivity human, mouse
Host / Isotype Rabbit / IgG
Class Recombinant
Type Antibody
Immunogen

CatNo: Ag2484

Product name: Recombinant human RBBP6 protein

Source: e coli.-derived, PGEX-4T

Tag: GST

Domain: 1-118 aa of BC029352

Sequence: MSCVHYKFSSKLNYDTVTFDGLHISLCDLKKQIMGREKLKAADCDLQITNAQTKEEYTDDNALIPKNSSVIVRRIPIGGVKSTSKTYVISRTEPAMATTKAVCKNTISHFFYTLLLPL

Predict reactive species
Full Name retinoblastoma binding protein 6
Calculated Molecular Weight 1792 aa, 200 kDa
Observed Molecular Weight250 kDa
GenBank Accession NumberBC029352
Gene Symbol RBBP6
Gene ID (NCBI) 5930
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ7Z6E9
Storage Buffer PBS only, pH 7.3.
Storage ConditionsStore at -80°C.

Background Information

RBBP6 (retinoblastoma binding protein 6) is a multifunctional protein that interacts with both p53 and pRb and has been implicated in mRNA processing. It has also been identified as a putative E3 ubiquitin ligase due to the presence of a RING finger domain [PMID:18851979]. RBBP6 contains an N-terminal ubiquitin-like domain and a cysteine-rich RING finger-like domain, through which it promotes the ubiquitination of p53 by Hdm2 in an E4-like manner [PMID:17470788]. It is implicated in a diverse set of cellular functions, including mRNA metabolism, regulation of the cell cycle, tumorigenesis, and development [PMID:12938151,17470788].

Loading...