RBM14 Polyclonal antibody

• 

  WB analysis of Jurkat using 10196-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10196-1-AP (RBM14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 10196-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 10196-1-AP (RBM14 antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 10196-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 10196-1-AP (RBM14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• 

  WB analysis of Jurkat using 10196-1-AP

  Jurkat cells were subjected to SDS PAGE followed by western blot with 10196-1-AP (RBM14 antibody) at dilution of 1:800 incubated at room temperature for 1.5 hours.

• Featured Product
• KD/KO Validated

RBM14 Polyclonal Antibody for WB, ELISA

Cat No. 10196-1-AP

Publications(7)

Host / Isotype

Rabbit / IgG

Reactivity

human and More (1)

Applications

WB, IF, ELISA

Synonyms

RNA-binding protein 14, RNA-binding motif protein 14, RNA binding protein 14, PSP2, Paraspeckle protein 2

---

Tested Applications

• Positive WB detected in: Jurkat cells, HeLa cells, HEK-293 cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 1 publications below
• WB: See 7 publications below
• IF: See 1 publications below

Product Information

10196-1-AP targets RBM14 in WB, IF, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Cited Reactivity: human, pig
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag0254

  Product name: Recombinant human RBM14 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 465-666 aa of BC000488

  Sequence: PVVQTQLNSYGAQASMGLSGSYGAQSAAAATGSYGAAAAYGAQPSATLAAPYRTQSSASLAASYAAQQHPQAAASYRGQPGNAYDGAGQPSAAYLSMSQGAVANANSTPPPYERTRLSPPRASYDDPYKKAVAMSKRYGSDRRLAELSDYRRLSESQLSFRRSPTKSSLDYRRLPDAHSDYARYSGSYNDYLRAAQMHSGYQ

• Full Name: RNA binding motif protein 14
• Calculated Molecular Weight: 70 kDa
• Observed Molecular Weight: 70-75 kDa
• GenBank Accession Number: BC000488
• Gene Symbol: RBM14
• Gene ID (NCBI): 10432
• RRID: AB_2175748
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q96PK6
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM14 is a ribonucleoprotein that functions as a general nuclear coactivator, and an RNA splicing modulator. This protein contains two RNA recognition motifs (RRM) at the N-terminus, and multiple hexapeptide repeat domain at the C-terminus that interacts with thyroid hormone receptor-binding protein (TRBP), and is required for transcription activation.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
	WB	Nat Struct Mol Biol; TDP-43 aggregation induced by oxidative stress causes global mitochondrial imbalance in ALS.; Authors - Xinxin Zuo
human	WB	Exp Mol Med; The deubiquitinating enzyme STAMBP is a newly discovered driver of triple-negative breast cancer progression that maintains RAI14 protein stability; Authors - Qianqian Yang
human	WB	Brain Res; Immunoprecipitation and mass spectrometry defines an extensive RBM45 protein-protein interaction network.; Authors - Yang Li
human	WB	Transl Cancer Res; Molecular mechanism of RBM14-mediated promotion of proliferation, migration, and invasion in osteosarcoma; Authors - Sijian Lin ; KD Validated
human	WB	J Transl Med; A diagnostic model for Parkinson's disease based on circadian rhythm-related genes; Authors - Lufeng Wang
pig,human	WB,IF	Int J Biol Macromol; Subcellular proteomics reveals the crosstalk between nucleocytoplasmic trafficking and the innate immune response to Senecavirus A infection; Authors - Mingyang Li