Tested Applications
| Positive WB detected in | HeLa cells, MCF-7 cells, A375 cells, Raji cells, HepG2 cells, Jurkat cells, NIH/3T3 cells |
| Positive IHC detected in | human testis tissue, human lung tissue, human brain tissue, human kidney tissue, human spleen tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
| Positive IF/ICC detected in | HeLa cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:5000-1:50000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| Immunofluorescence (IF)/ICC | IF/ICC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Published Applications
| KD/KO | See 7 publications below |
| WB | See 33 publications below |
| IHC | See 7 publications below |
| IF | See 3 publications below |
| IP | See 1 publications below |
| RIP | See 3 publications below |
Product Information
14363-1-AP targets RBM3 in WB, IHC, IF/ICC, IP, RIP, ELISA applications and shows reactivity with human, mouse samples.
| Tested Reactivity | human, mouse |
| Cited Reactivity | human, mouse, squirrel |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag5934 Product name: Recombinant human RBM3 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-157 aa of BC006825 Sequence: MSSEEGKLFVGGLNFNTDEQALEDHFSSFGPISEVVVVKDRETQRSRGFGFITFTNPEHASVAMRAMNGESLDGRQIRVDHAGKSARGTRGGGFGAHGRGRSYSRGGGDQGYGSGRYYDSRPGGYGYGYGRSRDYNGRNQGGYDRYSGGNYRDNYDN Predict reactive species |
| Full Name | RNA binding motif (RNP1, RRM) protein 3 |
| Calculated Molecular Weight | 17 kDa |
| Observed Molecular Weight | 17-20 kDa |
| GenBank Accession Number | BC006825 |
| Gene Symbol | RBM3 |
| Gene ID (NCBI) | 5935 |
| RRID | AB_2269266 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P98179 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBM3, also named as RNPL, is a cold-inducible mRNA binding protein that enhances global protein synthesis at both physiological and mild hypothermic temperatures. It reduces the relative abundance of microRNAs, when overexpressed. RBM3 enhances phosphoryaltion of translation initiation factors and active polysome formation. It is up-regulated in human tumors. RBM3 is a potential proto-oncogenic proteins upon overexpression. (PMID: 19900510 ).
Protocols
| Product Specific Protocols | |
|---|---|
| IF protocol for RBM3 antibody 14363-1-AP | Download protocol |
| IHC protocol for RBM3 antibody 14363-1-AP | Download protocol |
| WB protocol for RBM3 antibody 14363-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
| Species | Application | Title |
|---|---|---|
Nature RBM3 mediates structural plasticity and protective effects of cooling in neurodegeneration.
| ||
Cell iPSCs from a Hibernator Provide a Platform for Studying Cold Adaptation and Its Potential Medical Applications. | ||
EBioMedicine The RNA-binding protein RBM3 promotes cell proliferation in hepatocellular carcinoma by regulating circular RNA SCD-circRNA 2 production. | ||
Clin Transl Med LncRNA BC promotes lung adenocarcinoma progression by modulating IMPAD1 alternative splicing | ||
J Cell Biol Cold-induced protein RBM3 orchestrates neurogenesis via modulating Yap mRNA stability in cold stress.
| ||
Front Cell Dev Biol The RNA-Binding Protein RBM3 Promotes Neural Stem Cell (NSC) Proliferation Under Hypoxia. |































