RBM39 Monoclonal antibody

RBM39 Monoclonal Antibody for WB, IHC, IF/ICC, ELISA
Cat No. 67420-1-Ig
Clone No.2D2C8

Host / Isotype

Mouse / IgG2b

Reactivity

Human, mouse, rat

Applications

WB, IHC, IF/ICC, ELISA

CAPER, CAPERalpha, CC1.3, DKFZp781C0423, FLJ44170, fSAP59, HCC1, RBM39, RNA binding motif protein 39, RNA binding protein 39, RNPC2, Splicing factor HCC1

Formulation:  PBS and Azide
PBS and Azide
PBS Only
Conjugate:  Unconjugated
Size/Concentration: 

-/ -

Freight/Packing: -

Quantity

Please visit your regions distributor:


Tested Applications

Positive WB detected inCaco-2 cells, HeLa cells, LNCaP cells, HEK-293 cells, HepG2 cells, Jurkat cells, HSC-T6 cells, NIH/3T3 cells, Neuro-2a cells
Positive IHC detected inhuman breast cancer tissue
Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
Positive IF/ICC detected inHepG2 cells

Recommended dilution

ApplicationDilution
Western Blot (WB)WB : 1:5000-1:50000
Immunohistochemistry (IHC)IHC : 1:150-1:600
Immunofluorescence (IF)/ICCIF/ICC : 1:50-1:500
It is recommended that this reagent should be titrated in each testing system to obtain optimal results.
Sample-dependent, Check data in validation data gallery.

Product Information

67420-1-Ig targets RBM39 in WB, IHC, IF/ICC, ELISA applications and shows reactivity with Human, mouse, rat samples.

Tested Reactivity Human, mouse, rat
Host / Isotype Mouse / IgG2b
Class Monoclonal
Type Antibody
Immunogen

CatNo: Ag15766

Product name: Recombinant human RBM39 protein

Source: e coli.-derived, PET28a

Tag: 6*His

Domain: 328-530 aa of BC141835

Sequence: ERTDASSASSFLDSDELERTGIDLGTTGRLQLMARLAEGTGLQIPPAAQQALQMSGSLAFGAVAEFSFVIDLQTRLSQQTEASALAAAASVQPLATQCFQLSNMFNPQTEEEVGWDTEIKDDVIEECNKHGGVIHIYVDKNSAQGNVYVKCPSIAAAIAAVNALHGRWFAGKMITAAYVPLPTYHNLFPDSMTATQLLVPSRR

Predict reactive species
Full Name RNA binding motif protein 39
Calculated Molecular Weight 530 aa, 59 kDa
Observed Molecular Weight 60-66 kDa
GenBank Accession NumberBC141835
Gene Symbol RBM39
Gene ID (NCBI) 9584
RRIDAB_2882660
Conjugate Unconjugated
FormLiquid
Purification MethodProtein A purification
UNIPROT IDQ14498
Storage Buffer PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
Storage ConditionsStore at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RBM39, also named as HCC1 or RNPC2, is a 530 amino acid protein, which contains three RRM (RNA recognition motif) domains and belongs to the splicing factor SR family. RBM39 is widely expressed in various tissues and with highly expression in pancreas, skeletal muscle, lung and brain. RBM39 is a transcriptional coactivator for steroid nuclear receptors ESR1/ER-alpha and ESR2/ER-beta, and JUN/AP-1. RBM39 may be involved in pre-mRNA splicing process.

Protocols

Product Specific Protocols
WB protocol for RBM39 antibody 67420-1-IgDownload protocol
IHC protocol for RBM39 antibody 67420-1-IgDownload protocol
IF protocol for RBM39 antibody 67420-1-IgDownload protocol
Standard Protocols
Click here to view our Standard Protocols
Loading...
||
New chat Able
正在加载,请稍候...