Tested Applications
| Positive WB detected in | mouse testis tissue, rat testis tissue |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:2000-1:16000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
27987-1-AP targets RBMXL2 in WB, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag27624 Product name: Recombinant human RBMXL2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 271-392 aa of BC057796 Sequence: GDHLSRGSHREPFESYGELRGAAPGRGTPPSYGGGGRYEEYRGYSPDAYSGGRDSYSSSYGRSDRYSRGRHRVGRPDRGLSLSMERGCPPQRDSYSRSGCRVPRGGGRLGGRLERGGGRSRY Predict reactive species |
| Full Name | RNA binding motif protein, X-linked-like 2 |
| Calculated Molecular Weight | 43 kDa |
| Observed Molecular Weight | 43 kDa |
| GenBank Accession Number | BC057796 |
| Gene Symbol | RBMXL2 |
| Gene ID (NCBI) | 27288 |
| RRID | AB_3669632 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | O75526 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RBMXL2 (RNA-binding motif protein, X-linked-like-2), also known as heterogeneous nuclear ribonucleoproteins G-testis or hnRNP-GT, is a testis-specific nuclear RNA binding protein that plays a crucial role in male meiosis (PMID: 34927545). The protein is part of an anciently diverged family of RNA-binding proteins and shares significant homology with RBMX, another RNA-binding protein that is important for controlling splicing, transcription, and genome stability (PMID: 39356106). The expression of RBMXL2 is restricted to the testis, and it is highly expressed during the pachytene and diplotene stages of meiosis, which are characterized by high levels of transcription and alternative splicing (PMID: 34927545).
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RBMXL2 antibody 27987-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Celine (Verified Customer) (02-10-2026) | The recommended dilution of 1/2000 was perfect for the detection.
|

