Tested Applications
Positive WB detected in | Jurkat cells, Raji cells |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:3000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
24664-1-AP targets RBPJL in WB, ELISA applications and shows reactivity with human samples.
Tested Reactivity | human |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag20284 Product name: Recombinant human RBPJL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 428-517 aa of BC156875 Sequence: SPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT Predict reactive species |
Full Name | recombination signal binding protein for immunoglobulin kappa J region-like |
Calculated Molecular Weight | 517 aa, 57 kDa |
Observed Molecular Weight | 57-69 kDa |
GenBank Accession Number | BC156875 |
Gene Symbol | RBPJL |
Gene ID (NCBI) | 11317 |
RRID | AB_2879663 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9UBG7 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RBPJL antibody 24664-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |