Tested Applications
| Positive WB detected in | Jurkat cells, Raji cells |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:500-1:3000 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
24664-1-AP targets RBPJL in WB, ELISA applications and shows reactivity with human samples.
| Tested Reactivity | human |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag20284 Product name: Recombinant human RBPJL protein Source: e coli.-derived, PET28a Tag: 6*His Domain: 428-517 aa of BC156875 Sequence: SPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT Predict reactive species |
| Full Name | recombination signal binding protein for immunoglobulin kappa J region-like |
| Calculated Molecular Weight | 517 aa, 57 kDa |
| Observed Molecular Weight | 57-69 kDa |
| GenBank Accession Number | BC156875 |
| Gene Symbol | RBPJL |
| Gene ID (NCBI) | 11317 |
| RRID | AB_2879663 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9UBG7 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
| Product Specific Protocols | |
|---|---|
| WB protocol for RBPJL antibody 24664-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |





