RBPJL Polyclonal antibody, PBS Only

• 

  WB analysis of Jurkat using 24664-1-AP (same clone as 24664-1-PBS)

  Jurkat cells were subjected to SDS PAGE followed by western blot with 24664-1-AP (RBPJL Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24664-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 24664-1-AP (same clone as 24664-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 24664-1-AP (RBPJL Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24664-1-PBS in a different storage buffer formulation.

• 

  WB analysis of Raji using 24664-1-AP (same clone as 24664-1-PBS)

  Raji cells were subjected to SDS PAGE followed by western blot with 24664-1-AP (RBPJL Antibody) at dilution of 1:1500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 24664-1-PBS in a different storage buffer formulation.

RBPJL Polyclonal Antibody for WB, Indirect ELISA

Cat No. 24664-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, Indirect ELISA

Synonyms

---

Product Information

24664-1-PBS targets RBPJL in WB, Indirect ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag20284

  Product name: Recombinant human RBPJL protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 428-517 aa of BC156875

  Sequence: SPRSLVCVVPDVAAFCSDWRWLRAPITIPMSLVRADGLFYPSAFSFTYTPEYSVRPGHPGVPEPATDADALLESIHQEFTRTNFHLFIQT

• Full Name: recombination signal binding protein for immunoglobulin kappa J region-like
• Calculated Molecular Weight: 517 aa, 57 kDa
• Observed Molecular Weight: 57-69 kDa
• GenBank Accession Number: BC156875
• Gene Symbol: RBPJL
• Gene ID (NCBI): 11317
• RRID: AB_2879663
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9UBG7
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.