REEP3 Polyclonal antibody

• 

  WB analysis using 23140-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 23140-1-AP (REEP3 antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

REEP3 Polyclonal Antibody for WB, ELISA

Cat No. 23140-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

WB, ELISA

Synonyms

C10orf74, receptor accessory protein 3

---

Tested Applications

• Positive WB detected in: HeLa cells, L02 cells, MCF-7 cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:4000

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

23140-1-AP targets REEP3 in WB, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag19400

  Product name: Recombinant human REEP3 protein

  Source: e coli.-derived, PET28a

  Tag: 6*His

  Domain: 73-255 aa of BC068557

  Sequence: VIWLLSPYTKGASLIYRKFLHPLLSSKEREIDDYIVQAKERGYETMVNFGRQGLNLAATAAVTAAVKSQGAITERLRSFSMHDLTTIQGDEPVGQRPYQPLPEAKKKSKPAPSESAGYGIPLKDGDEKTDEEAEGPYSDNEMLTHKGLRRSQSMKSVKTTKGRKEVRYGSLKYKVKKRPQVYF

• Full Name: receptor accessory protein 3
• Calculated Molecular Weight: 255 aa, 29 kDa
• Observed Molecular Weight: 29 kDa
• GenBank Accession Number: BC068557
• Gene Symbol: REEP3
• Gene ID (NCBI): 221035
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6NUK4
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

REEP3 (Receptor Expression-Enhancing Protein 3) is a member of the REEP family of proteins, a transmembrane protein that interacts with odorant receptor proteins and may enhance the odorant receptor responses to odorants. It primarily regulates the tubular morphology of the endoplasmic reticulum by promoting high membrane curvature through its reticular homology domains. During mitosis, REEP3 binds to microtubules, separating the endoplasmic reticulum from chromosomes to ensure proper nuclear membrane remodeling and cell division.(PMID: 23911198; 30995177)