Tested Applications
Positive WB detected in | fetal human brain tissue, mouse brain tissue |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:2000 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
25371-1-AP targets REM2 in WB, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag21991 Product name: Recombinant human REM2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-110 aa of BC035663 Sequence: MDTETTALCPSGSRRASPPGTPTPEADATLLKKSEKLLAELDRSGLPSAPGAPRRRGSMPVPYKHQLRRAQAVDELDWPPQASSSGSSDSLGSGEAAPAQKDGIFKVMLV Predict reactive species |
Full Name | RAS (RAD and GEM)-like GTP binding 2 |
Calculated Molecular Weight | 340 aa, 37 kDa |
Observed Molecular Weight | 37 kDa |
GenBank Accession Number | BC035663 |
Gene Symbol | REM2 |
Gene ID (NCBI) | 161253 |
RRID | AB_2880049 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8IYK8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
Rem2 is a member of the RGK subfamily of RAS small GTPases. Rem2 inhibits high voltage activated calcium channels, is involved in synaptogenesis, and regulates dendritic morphology. Rem2 is the primary RGK protein expressed in the nervous system, but to date, the precise expression patterns of this protein are unknown.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for REM2 antibody 25371-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |