Tested Applications
Positive WB detected in | mouse liver tissue, L02 cells |
Positive IHC detected in | human placenta tissue, human heart tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:20-1:200 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Product Information
15598-1-AP targets REXO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag7976 Product name: Recombinant human REX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC003502 Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT Predict reactive species |
Full Name | REX2, RNA exonuclease 2 homolog (S. cerevisiae) |
Calculated Molecular Weight | 27 kDa |
Observed Molecular Weight | 27-30 kDa |
GenBank Accession Number | BC003502 |
Gene Symbol | REXO2 |
Gene ID (NCBI) | 25996 |
RRID | AB_10640529 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q9Y3B8 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
WB protocol for REXO2 antibody 15598-1-AP | Download protocol |
IHC protocol for REXO2 antibody 15598-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Reviews
The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.
FH Vanessa (Verified Customer) (01-11-2021) | Unfortunately, did not obtain a band at the specified size, and could only see a unspecific band see in mitochondrial fractions.
![]() |