REXO2 Polyclonal antibody

• 

  WB analysis of mouse liver using 15598-1-AP

  mouse liver tissue were subjected to SDS PAGE followed by western blot with 15598-1-AP (REXO2 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  WB analysis of L02 using 15598-1-AP

  L02 cells were subjected to SDS PAGE followed by western blot with 15598-1-AP (REXO2 antibody) at dilution of 1:200 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human placenta using 15598-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 15598-1-AP (REXO2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human placenta using 15598-1-AP

  Immunohistochemical analysis of paraffin-embedded human placenta using 15598-1-AP (REXO2 antibody) at dilution of 1:50 (under 40x lens).

• 

  IHC staining of human heart using 15598-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15598-1-AP (REXO2 antibody) at dilution of 1:50 (under 10x lens).

• 

  IHC staining of human heart using 15598-1-AP

  Immunohistochemical analysis of paraffin-embedded human heart using 15598-1-AP (REXO2 antibody) at dilution of 1:50 (under 40x lens).

REXO2 Polyclonal Antibody for WB, IHC, ELISA

Cat No. 15598-1-AP

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, ELISA

Synonyms

CGI 114, REX2, REXO2, RFN, RNA exonuclease 2 homolog, SFN, Small fragment nuclease, SMFN

---

Tested Applications

• Positive WB detected in: mouse liver tissue, L02 cells
• Positive IHC detected in: human placenta tissue, human heart tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:1000
• Immunohistochemistry (IHC): IHC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

15598-1-AP targets REXO2 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag7976

  Product name: Recombinant human REX2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-79 aa of BC003502

  Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT

• Full Name: REX2, RNA exonuclease 2 homolog (S. cerevisiae)
• Calculated Molecular Weight: 27 kDa
• Observed Molecular Weight: 27-30 kDa
• GenBank Accession Number: BC003502
• Gene Symbol: REXO2
• Gene ID (NCBI): 25996
• RRID: AB_10640529
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9Y3B8
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Vanessa (Verified Customer) (01-11-2021)

Unfortunately, did not obtain a band at the specified size, and could only see a unspecific band see in mitochondrial fractions.

• Applications: Western Blot
• Primary Antibody Dilution: 1:300
• Cell Tissue Type: Mammalian cells Human & mouse

REXO2 Antibody Western Blot validation (1:300 dilution) in Mammalian cells Human & mouse (Cat no:15598-1-AP)