Product Information
15598-1-PBS targets REXO2 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag7976 Product name: Recombinant human REX2 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-79 aa of BC003502 Sequence: MLGGSLGSRLLRGVGGSHGRFGARGVREGGAAMAAGESMAQRMVWVDLEMTGLDIEKDQIIEMACLITDSDLNILAEGT Predict reactive species |
| Full Name | REX2, RNA exonuclease 2 homolog (S. cerevisiae) |
| Calculated Molecular Weight | 27 kDa |
| Observed Molecular Weight | 27-30 kDa |
| GenBank Accession Number | BC003502 |
| Gene Symbol | REXO2 |
| Gene ID (NCBI) | 25996 |
| RRID | AB_10640529 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q9Y3B8 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |











