RFXAP Polyclonal antibody

• 

  WB analysis using 20188-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 20188-1-AP (RFXAP antibody) at dilution of 1:3000 incubated at room temperature for 1.5 hours.

• 

  IF Staining of HeLa using 20188-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 20188-1-AP (RFXAP antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

RFXAP Polyclonal Antibody for WB, IF/ICC, ELISA

Cat No. 20188-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

WB, IF/ICC, ELISA

Synonyms

Regulatory factor X-associated protein, RFX associated protein, RFX DNA-binding complex 36 kDa subunit, RFX-associated protein

---

Tested Applications

• Positive WB detected in: HeLa cells, Jurkat cells, MOLT-4 cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:6000
• Immunofluorescence (IF)/ICC: IF/ICC : 1:20-1:200

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

20188-1-AP targets RFXAP in WB, IF/ICC, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag14100

  Product name: Recombinant human RFXAP protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 80-272 aa of BC026088

  Sequence: DGEEEAGEDEADLLDTSDPPGGGESAASLEDLEDEETHSGGEGSSGGARRRGSGGGSMSKTCTYEGCSETTSQVAKQRKPWMCKKHRNKMYKDKYKKKKSDQALNCGGTASTGSAGNVKLEESADNILSIVKQRTGSFGDRPARPTLLEQVLNQKRLSLLRSPEVVQFLQKQQQLLNQQVLEQRQQQFPGTSM

• Full Name: regulatory factor X-associated protein
• Calculated Molecular Weight: 272 aa, 28 kDa
• Observed Molecular Weight: 36 kDa
• GenBank Accession Number: BC026088
• Gene Symbol: RFXAP
• Gene ID (NCBI): 5994
• RRID: AB_10697835
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: O00287
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RFXAP is a subunit of the RFX complex that binds to the X-box of MHC II promoters. It's involved in Bare lymphocyte syndrome 2 (BLS2).