Filter: AllWBIPIHC

WB analysis using 17947-1-AP (same clone as 17947-1-PBS)
Various lysates were subjected to SDS PAGE followed by western blot with 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:8000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
WB analysis of mouse small intestine using 17947-1-AP (same clone as 17947-1-PBS)
mouse small intestine tissue were subjected to SDS PAGE followed by western blot with 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IP experiment of mouse liver using 17947-1-AP (same clone as 17947-1-PBS)
IP result of anti-RGN/SMP30 (IP:17947-1-AP, 4ug; Detection:17947-1-AP 1:15000) with mouse liver tissue lysate 3040 ug. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of rat kidney using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded rat kidney tissue slide using 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:50 (under 10x lens). This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human hepatocirrhosis using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human hepatocirrhosis using 17947-1-AP (RGN/SMP30 antibody) at dilution of 1:50 (under 40x lens). This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney slide using 17947-1-AP (RGN/SMP30 antibody at dilution of 1:50. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human kidney using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human kidney slide using 17947-1-AP (RGN/SMP30 antibody at dilution of 1:50. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver slide using 17947-1-AP (RGN/SMP30 antibody at dilution of 1:50. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.
IHC staining of human liver using 17947-1-AP (same clone as 17947-1-PBS)
Immunohistochemical analysis of paraffin-embedded human liver slide using 17947-1-AP (RGN/SMP30 antibody at dilution of 1:50. This data was developed using the same antibody clone with 17947-1-PBS in a different storage buffer formulation.

RGN/SMP30 Polyclonal antibody, PBS Only

RGN/SMP30 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 17947-1-PBS

Review Product

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

Formulation: PBS Only

PBS and Azide

PBS Only

Conjugate: Unconjugated

Size/Concentration:

-/ -

Freight/Packing: -

Quantity

- +

Request bulk or custom quote

Proteintech Guarantee

Overview

Tested Applications
Product Information

Print datasheet

MSDS SDS

Product Information

17947-1-PBS targets RGN/SMP30 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

Tested Reactivity	human, mouse, rat
Host / Isotype	Rabbit / IgG
Class	Polyclonal
Type	Antibody
Immunogen	CatNo: Ag12423 Product name: Recombinant human RGN,SMP30 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-299 aa of BC073173 Sequence: MSSIKIECVLPENCRCGESPVWEEVSNSLLFVDIPAKKVCRWDSFTKQVQRVTMDAPVSSVALRQSGGYVATIGTKFCALNWKEQSAVVLATVDNDKKNNRFNDGKVDPAGRYFAGTMAEETAPAVLERHQGALYSLFPDHHVKKYFDQVDISNGLDWSLDHKIFYYIDSLSYSVDAFDYDLQTGQISNRRSVYKLEKEEQIPDGMCIDAEGKLWVACYNGGRVIRLDPVTGKRLQTVKLPVDKTTSCCFGGKNYSEMYVTCARDGMDPEGLLRQPEAGGIFKITGLGVKGIAPYSYAG Predict reactive species
Full Name	regucalcin (senescence marker protein-30)
Calculated Molecular Weight	299 aa, 33 kDa
Observed Molecular Weight	33 kDa, 25 kDa
GenBank Accession Number	BC073173
Gene Symbol	RGN/SMP30
Gene ID (NCBI)	9104
RRID	AB_10644486
Conjugate	Unconjugated
Form	Liquid
Purification Method	Antigen affinity purification
UNIPROT ID	Q15493
Storage Buffer	PBS only, pH 7.3.
Storage Conditions	Store at -80°C.

Background Information

Regucalcin (RGN), also known as SMP30, is a highly conserved, calcium-binding protein, that is preferentially expressed in the liver and kidney. SMP30 is preferentially localized in hepatocytes and renal proximal tubular epithelial cells. It is known to be related to aging, hepatocyte proliferation and tumorigenesis. It may be useful for HCC serologic screening, especially for the patients with AFP Negative. RGN encodes two isoforms: 33 kDa and 25 kDa.