RGR Polyclonal antibody, PBS Only

• 

  WB analysis of human heart using 11904-1-AP (same clone as 11904-1-PBS)

  human heart tissue were subjected to SDS PAGE followed by western blot with 11904-1-AP (RGR antibody) at dilution of 1:500 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 11904-1-PBS in a different storage buffer formulation.

• 

  IP experiment of PC-3 using 11904-1-AP (same clone as 11904-1-PBS)

  IP result of anti-RGR (IP:11904-1-AP, 4ug; Detection:11904-1-AP 1:300) with PC-3 cells lysate 4000ug. This data was developed using the same antibody clone with 11904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse retina using 11904-1-AP (same clone as 11904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse retina tissue slide using 11904-1-AP (RGR antibody) at dilution of 1:1000 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse retina using 11904-1-AP (same clone as 11904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse retina tissue slide using 11904-1-AP (RGR antibody) at dilution of 1:1000 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 11904-1-PBS in a different storage buffer formulation.

• 

  IHC staining of human prostate cancer using 11904-1-AP (same clone as 11904-1-PBS)

  Immunohistochemical analysis of paraffin-embedded human prostate cancer using 11904-1-AP (RGR antibody) at dilution of 1:100 (under 10x lens). This data was developed using the same antibody clone with 11904-1-PBS in a different storage buffer formulation.

RGR Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 11904-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

11904-1-PBS targets RGR in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag2552

  Product name: Recombinant human RGR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-120 aa of BC008094

  Sequence: MAETSALPTGFGELEVLAVGMVLLVEDPGAADSLPPTGAELGSCGQWDQPECPRCSHIQPSPCLPQALALRLGRLPGSRLPGLCDSVGQHLQQCSHRMGALSPLLHPPKCCHRSHHFEWR

• Full Name: retinal G protein coupled receptor
• Calculated Molecular Weight: 32 kDa
• Observed Molecular Weight: 32 kDa, 26 kDa
• GenBank Accession Number: BC008094
• Gene Symbol: RGR
• Gene ID (NCBI): 5995
• RRID: AB_2179498
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P47804
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RGR is a G protein-coupled receptor preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The gene of PGR may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.