Product Information
11904-1-PBS targets RGR in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag2552 Product name: Recombinant human RGR protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 1-120 aa of BC008094 Sequence: MAETSALPTGFGELEVLAVGMVLLVEDPGAADSLPPTGAELGSCGQWDQPECPRCSHIQPSPCLPQALALRLGRLPGSRLPGLCDSVGQHLQQCSHRMGALSPLLHPPKCCHRSHHFEWR Predict reactive species |
| Full Name | retinal G protein coupled receptor |
| Calculated Molecular Weight | 32 kDa |
| Observed Molecular Weight | 32 kDa, 26 kDa |
| GenBank Accession Number | BC008094 |
| Gene Symbol | RGR |
| Gene ID (NCBI) | 5995 |
| RRID | AB_2179498 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | P47804 |
| Storage Buffer | PBS only, pH 7.3. |
| Storage Conditions | Store at -80°C. |
Background Information
RGR is a G protein-coupled receptor preferentially expressed at high levels in the retinal pigment epithelium (RPE) and Mueller cells of the neural retina. Like other opsins which bind retinaldehyde, it contains a conserved lysine residue in the seventh transmembrane domain. RGR acts as a photoisomerase to catalyze the conversion of all-trans-retinal to 11-cis-retinal. The reverse isomerization occurs with rhodopsin in retinal photoreceptor cells. The gene of PGR may be associated with autosomal recessive and autosomal dominant retinitis pigmentosa (arRP and adRP, respectively). Alternative splicing results in multiple transcript variants encoding different isoforms.









