Tested Applications
Positive WB detected in | mouse kidney tissue, HEK-293 cells, mouse testis tissue, PC-3 cells |
Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:1000-1:6000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
KD/KO | See 2 publications below |
WB | See 4 publications below |
Product Information
20869-1-AP targets RHBDD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
Tested Reactivity | human, mouse, rat |
Cited Reactivity | human, mouse |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag14932 Product name: Recombinant human RHBDD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 13-106 aa of BC027900 Sequence: SSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ Predict reactive species |
Full Name | rhomboid domain containing 1 |
Calculated Molecular Weight | 315 aa, 36 kDa |
Observed Molecular Weight | 36 kDa |
GenBank Accession Number | BC027900 |
Gene Symbol | RHBDD1 |
Gene ID (NCBI) | 84236 |
RRID | AB_10733756 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | Q8TEB9 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Protocols
Product Specific Protocols | |
---|---|
IHC protocol for RHBDD1 antibody 20869-1-AP | Download protocol |
WB protocol for RHBDD1 antibody 20869-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |
Publications
Species | Application | Title |
---|---|---|
J Biol Chem AAA-ATPase valosin-containing protein (VCP) binds the transcription factor SREBP1 and promotes its proteolytic activation by rhomboid protease RHBDL4. | ||
Environ Toxicol Suppression of rhomboid domain-containing 1 produces anticancer effects in pancreatic adenocarcinoma through affection of the AKT/GSK-3β/β-catenin pathway.
| ||
Cell Death Dis Long noncoding RNA AFAP1-AS1 promotes tumor progression and invasion by regulating the miR-2110/Sp1 axis in triple-negative breast cancer. | ||
Genes Cells Mouse transient receptor potential melastatin 2 (TRPM2) isoform 7 attenuates full-length mouse TRPM2 activity through reductions in its expression by targeting it to ER-associated degradation
|