Tested Applications
| Positive WB detected in | mouse kidney tissue, HCT 116 cells, HEK-293 cells, mouse testis tissue, PC-3 cells, human testis tissue, mouse colon tissue |
| Positive IHC detected in | human testis tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
| Application | Dilution |
|---|---|
| Western Blot (WB) | WB : 1:1000-1:6000 |
| Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
| It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
| Sample-dependent, Check data in validation data gallery. | |
Product Information
20869-1-AP targets RHBDD1 in WB, IHC, ELISA applications and shows reactivity with human, mouse, rat samples.
| Tested Reactivity | human, mouse, rat |
| Cited Reactivity | human, mouse |
| Host / Isotype | Rabbit / IgG |
| Class | Polyclonal |
| Type | Antibody |
| Immunogen |
CatNo: Ag14932 Product name: Recombinant human RHBDD1 protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 13-106 aa of BC027900 Sequence: SSSVGYPGRQYYFNSSGSSGYQDYYPHGRPDHYEEAPRNYDTYTAGLSEEEQLERALQASLWDRGNTRNSPPPYGFHLSPEEMRRQRLHRFDSQ Predict reactive species |
| Full Name | rhomboid domain containing 1 |
| Calculated Molecular Weight | 315 aa, 36 kDa |
| Observed Molecular Weight | 36 kDa |
| GenBank Accession Number | BC027900 |
| Gene Symbol | RHBDD1 |
| Gene ID (NCBI) | 84236 |
| RRID | AB_10733756 |
| Conjugate | Unconjugated |
| Form | Liquid |
| Purification Method | Antigen affinity purification |
| UNIPROT ID | Q8TEB9 |
| Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
| Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RHBDD1 (Rhomboid Domain Containing 1), also known as RHBDL4), is a rhomboid endomembrane serine protease located on the endoplasmic reticulum membrane. It plays a key role in cellular protein quality control, apoptosis and lipid homeostasis. RHBDD1 is capable of cleaving misfolded transmembrane proteins on the endoplasmic reticulum membrane, thereby facilitating their transport to the cytoplasm for degradation by the proteasome.
Protocols
| Product Specific Protocols | |
|---|---|
| IHC protocol for RHBDD1 antibody 20869-1-AP | Download protocol |
| WB protocol for RHBDD1 antibody 20869-1-AP | Download protocol |
| Standard Protocols | |
|---|---|
| Click here to view our Standard Protocols |
Publications
What published studies show
The RHBDD1 Polyclonal antibody (Cat# 20869-1-AP) has 5 total citations. These appear in Cell Death & Disease, Journal of Biological Chemistry, Environmental Toxicology, and Genes and Cells. The research fields span triple-negative breast cancer progression, VCP/SREBP1 proteolytic activation, pancreatic adenocarcinoma via the AKT/GSK-3β/β-catenin pathway, and TRPM2 isoform regulation through ER-associated degradation. All cited applications are Western blot in human or mouse samples.
| Species | Application | Title |
|---|---|---|
Cell Death Dis Long noncoding RNA AFAP1-AS1 promotes tumor progression and invasion by regulating the miR-2110/Sp1 axis in triple-negative breast cancer. | ||
J Biol Chem AAA-ATPase valosin-containing protein (VCP) binds the transcription factor SREBP1 and promotes its proteolytic activation by rhomboid protease RHBDL4. | ||
Environ Toxicol Suppression of rhomboid domain-containing 1 produces anticancer effects in pancreatic adenocarcinoma through affection of the AKT/GSK-3β/β-catenin pathway.
| ||
Genes Cells Mouse transient receptor potential melastatin 2 (TRPM2) isoform 7 attenuates full-length mouse TRPM2 activity through reductions in its expression by targeting it to ER-associated degradation
|















