Tested Applications
Positive WB detected in | mouse kidney tissue |
Positive IHC detected in | human stomach tissue Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0 |
Recommended dilution
Application | Dilution |
---|---|
Western Blot (WB) | WB : 1:500-1:1000 |
Immunohistochemistry (IHC) | IHC : 1:50-1:500 |
It is recommended that this reagent should be titrated in each testing system to obtain optimal results. | |
Sample-dependent, Check data in validation data gallery. |
Published Applications
WB | See 1 publications below |
Product Information
27213-1-AP targets RHOA in WB, IHC, ELISA applications and shows reactivity with human, mouse samples.
Tested Reactivity | human, mouse |
Cited Reactivity | rat |
Host / Isotype | Rabbit / IgG |
Class | Polyclonal |
Type | Antibody |
Immunogen |
CatNo: Ag25873 Product name: Recombinant human RHOA protein Source: e coli.-derived, PGEX-4T Tag: GST Domain: 123-161 aa of BC005976 Sequence: NDEHTRRELAKMKQEPVKPEEGRDMANRIGAFGYMECSA Predict reactive species |
Full Name | ras homolog gene family, member A |
Calculated Molecular Weight | 22 kDa |
Observed Molecular Weight | 22 kDa |
GenBank Accession Number | BC005976 |
Gene Symbol | RHOA |
Gene ID (NCBI) | 387 |
RRID | AB_2880803 |
Conjugate | Unconjugated |
Form | Liquid |
Purification Method | Antigen affinity purification |
UNIPROT ID | P61586 |
Storage Buffer | PBS with 0.02% sodium azide and 50% glycerol, pH 7.3. |
Storage Conditions | Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20oC storage. 20ul sizes contain 0.1% BSA. |
Background Information
RhoA is a member of the Rho family of small GTPases, which cycle between inactive GDP-bound and active GTP-bound states and function as molecular switches in signal transduction cascades. Rho proteins promote reorganization of the actin cytoskeleton and regulate cell shape, attachment, and motility. Overexpression of RhoA is associated with tumor cell proliferation and metastasis. RhoA signalling is critical to many cellular processes including migration, mechanotransduction, and is often disrupted in carcinogenesis.
Protocols
Product Specific Protocols | |
---|---|
WB protocol for RHOA antibody 27213-1-AP | Download protocol |
IHC protocol for RHOA antibody 27213-1-AP | Download protocol |
Standard Protocols | |
---|---|
Click here to view our Standard Protocols |