RICTOR Polyclonal antibody

• 

  WB analysis using 27248-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27248-1-AP (RICTOR antibody) at dilution of 1:4000 incubated at room temperature for 1.5 hours.

• 

  WB analysis using 27248-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 27248-1-AP (RICTOR antibody) at dilution of 1:2000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of NIH/3T3 using 27248-1-AP

  NIH/3T3 cells were subjected to SDS PAGE followed by western blot with 27248-1-AP (RICTOR Antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IHC staining of human lung cancer using 27248-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27248-1-AP (RICTOR antibody) at dilution of 1:200 (under 10x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 27248-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 27248-1-AP (RICTOR antibody) at dilution of 1:200 (under 40x lens. Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 27248-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27248-1-AP (RICTOR antibody) at dilution of 1:600 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse testis using 27248-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse testis tissue slide using 27248-1-AP (RICTOR antibody) at dilution of 1:600 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IF Staining of NIH/3T3 using 27248-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed NIH/3T3 cells using RICTOR antibody (27248-1-AP) at dilution of 1:200 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  IF Staining of HeLa using 27248-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using RICTOR antibody (27248-1-AP) at dilution of 1:400 and Multi-rAb CoraLite ® Plus 488-Goat Anti-Rabbit Recombinant Secondary Antibody (H+L) (RGAR002).

• 

  IF Staining of HeLa using 27248-1-AP

  Immunofluorescent analysis of (-20°C Ethanol) fixed HeLa cells using 27248-1-AP (RICTOR antibody) at dilution of 1:50 and CoraLite488-Conjugated AffiniPure Goat Anti-Rabbit IgG(H+L).

• Featured Product
• KD/KO Validated

RICTOR Polyclonal Antibody for WB, IHC, IF/ICC, ELISA

Cat No. 27248-1-AP

Publications(25)

Reviews (1)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse and More (1)

Applications

WB, IHC, IF/ICC, IP, ELISA

Synonyms

Rapamycin-insensitive companion of mTOR, KIAA1999, hAVO3, AVO3 homolog

---

Tested Applications

• Positive WB detected in: HEK-293 cells, NIH/3T3 cells, HeLa cells, HepG2 cells
• Positive IHC detected in: human lung cancer tissue, mouse testis tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0
• Positive IF/ICC detected in: NIH/3T3 cells, HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:1000-1:8000
• Immunohistochemistry (IHC): IHC : 1:50-1:500
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• KD/KO: See 2 publications below
• WB: See 22 publications below
• IHC: See 1 publications below
• IF: See 6 publications below
• IP: See 1 publications below

Product Information

27248-1-AP targets RICTOR in WB, IHC, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag25649

  Product name: Recombinant human RICTOR protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-51 aa of BC029608

  Sequence: MAAIGRGRSLKNLRVRGRNDSGEENVPLDLTREPSDNLREILQNVARLQGV

• Full Name: rapamycin-insensitive companion of mTOR
• Calculated Molecular Weight: 192 kDa
• Observed Molecular Weight: 192 kDa
• GenBank Accession Number: BC029608
• Gene Symbol: RICTOR
• Gene ID (NCBI): 253260
• RRID: AB_2880817
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q6R327
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
mouse	WB	Nat Neurosci; A glycolytic shift in Schwann cells supports injured axons.; Authors - Elisabetta Babetto
human	WB	Aging (Albany NY); Interleukin 6 promotes BMP9-induced osteoblastic differentiation through Stat3/mTORC1 in mouse embryonic fibroblasts; Authors - Shi-Yu Wang
mouse	WB,IF	Cell Rep; Mitochondrial dynamics define muscle fiber type by modulating cellular metabolic pathways; Authors - Tatsuki Yasuda
mouse	IF	J Cell Physiol; Identification of circular dorsal ruffles as signal platforms for the AKT pathway in glomerular podocytes; Authors - Rui Hua
human	WB	J Ethnopharmacol; Diterpenoid tanshinones inhibit gastric cancer angiogenesis through the PI3K/Akt/mTOR signaling pathway; Authors - Jie-Ru Yu
human	WB	Cell Commun Signal; Rapamycin promotes endothelial-mesenchymal transition during stress-induced premature senescence through the activation of autophagy.; Authors - Norihiko Sasaki

Reviews

The reviews below have been submitted by verified Proteintech customers who received an incentive for providing their feedback.

---

FH

Joleen (Verified Customer) (06-12-2019)

The antibody recognizes RICTOR which is around ~200kD. It is the top most band. The first two lanes were cell lysates and show that the antibody recognizes other proteins non-specifically. The last lane contained eluted proteins that are presumably proximal to the cell membrane. RICTOR shows up there cleanly.

• Applications: Western Blot,
• Primary Antibody Dilution: 1:1k
• Cell Tissue Type: MDCK GII

RICTOR Antibody Western Blot, validation (1:1k dilution) in MDCK GII (Cat no:27248-1-AP)