RIN1 Polyclonal antibody, PBS Only

• 

  WB analysis of HeLa using 16388-1-AP (same clone as 16388-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16388-1-AP (RIN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16388-1-PBS in a different storage buffer formulation.

• 

  WB analysis of HeLa using 16388-1-AP (same clone as 16388-1-PBS)

  HeLa cells were subjected to SDS PAGE followed by western blot with 16388-1-AP (RIN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 16388-1-PBS in a different storage buffer formulation.

• 

  IP experiment of HeLa using 16388-1-AP (same clone as 16388-1-PBS)

  IP result of anti-RIN1 (IP:16388-1-AP, 4ug; Detection:16388-1-AP 1:500) with HeLa cells lysate 3400ug. This data was developed using the same antibody clone with 16388-1-PBS in a different storage buffer formulation.

• 

  IF Staining of HeLa using 16388-1-AP (same clone as 16388-1-PBS)

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 16388-1-AP (RIN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated AffiniPure Goat Anti-Rabbit IgG(H+L). This data was developed using the same antibody clone with 16388-1-PBS in a different storage buffer formulation.

RIN1 Polyclonal Antibody for WB, IF/ICC, IP, Indirect ELISA

Cat No. 16388-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, Indirect ELISA

Synonyms

---

Product Information

16388-1-PBS targets RIN1 in WB, IF/ICC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9451

  Product name: Recombinant human RIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 434-783 aa of BC014417

  Sequence: KSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAFGSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFLPLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSRAAEE

• Full Name: Ras and Rab interactor 1
• Calculated Molecular Weight: 783 aa, 84 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC014417
• Gene Symbol: RIN1
• Gene ID (NCBI): 9610
• RRID: AB_2177839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13671
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.