RIN1 Polyclonal antibody

• 

  WB analysis of HeLa using 16388-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16388-1-AP (RIN1 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  WB analysis of HeLa using 16388-1-AP

  HeLa cells were subjected to SDS PAGE followed by western blot with 16388-1-AP (RIN1 antibody) at dilution of 1:300 incubated at room temperature for 1.5 hours.

• 

  IP experiment of HeLa using 16388-1-AP

  IP result of anti-RIN1 (IP:16388-1-AP, 4ug; Detection:16388-1-AP 1:500) with HeLa cells lysate 3400ug.

• 

  IF Staining of HeLa using 16388-1-AP

  Immunofluorescent analysis of (10% Formaldehyde) fixed HeLa cells using 16388-1-AP (RIN1 antibody) at dilution of 1:50 and Alexa Fluor 488-conjugated Goat Anti-Rabbit IgG(H+L).

RIN1 Polyclonal Antibody for WB, IF/ICC, IP, ELISA

Cat No. 16388-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IF/ICC, IP, ELISA

Synonyms

Ras interaction/interference protein 1, Ras inhibitor JC99, Ras and Rab interactor 1

---

Tested Applications

• Positive WB detected in: HeLa cells
• Positive IP detected in: HeLa cells
• Positive IF/ICC detected in: HeLa cells

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunofluorescence (IF)/ICC: IF/ICC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• WB: See 1 publications below
• IF: See 1 publications below

Product Information

16388-1-AP targets RIN1 in WB, IF/ICC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag9451

  Product name: Recombinant human RIN1 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 434-783 aa of BC014417

  Sequence: KSLHCSVLKPLRPILAARLRRRLAADGSLGRLAEGLRLARAQGPGAFGSHLSLPSPVELEQVRQKLLQLLRTYSPSAQVKRLLQACKLLYMALRTQEGEGAGADEFLPLLSLVLAHCDLPELLLEAEYMSELLEPSLLTGEGGYYLTSLSASLALLSGLGQAHTLPLSPVQELRRSLSLWEQRRLPATHCFQHLLRVAYQDPSSGCTSKTLAVPPEASIATLNQLCATKFRVTQPNTFGLFLYKEQGYHRLPPGALAHRLPTTGYLVYRRAEWPETQGAVTEEEGSGQSEARSRGEEQGCQGDGDAGVKASPRDIREQSETTAEGGQGQAQEGPAQPGEPEAEGSRAAEE

• Full Name: Ras and Rab interactor 1
• Calculated Molecular Weight: 783 aa, 84 kDa
• Observed Molecular Weight: 90 kDa
• GenBank Accession Number: BC014417
• Gene Symbol: RIN1
• Gene ID (NCBI): 9610
• RRID: AB_2177839
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q13671
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	WB	Comput Struct Biotechnol J; Structure-based discovery of neoandrographolide as a novel inhibitor of Rab5 to suppress cancer growth.; Authors - Jing Zhang
human	IF	Cell Commun Signal; Circular dorsal ruffles disturb the growth factor-induced PI3K-AKT pathway in hepatocellular carcinoma Hep3B cells.; Authors - Xiaowei Sun