RIPK4 Polyclonal antibody

• 

  IP experiment of SKOV-3 using 26458-1-AP

  IP result of anti-RIPK4 (IP:26458-1-AP, 4ug; Detection:26458-1-AP 1:300) with SKOV-3 cells lysate 2800ug.

• 

  IHC staining of human lung cancer using 26458-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26458-1-AP (RIPK4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human lung cancer using 26458-1-AP

  Immunohistochemical analysis of paraffin-embedded human lung cancer tissue slide using 26458-1-AP (RIPK4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 26458-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 26458-1-AP (RIPK4 Antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of human cervical cancer using 26458-1-AP

  Immunohistochemical analysis of paraffin-embedded human cervical cancer tissue slide using 26458-1-AP (RIPK4 Antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RIPK4 Polyclonal Antibody for IP, IHC, ELISA

Cat No. 26458-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human

Applications

IP, IHC, ELISA

Synonyms

ANKK2, ANKRD3, DIK, PKK, Protein kinase, RIP4, RIPK4

---

Tested Applications

• Positive IP detected in: SKOV-3 cells
• Positive IHC detected in: human lung cancer tissue, human cervical cancer tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26458-1-AP targets RIPK4 in IP, IHC, ELISA applications and shows reactivity with human samples.

• Tested Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag24202

  Product name: Recombinant human RIPK4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-67 aa of BC110617

  Sequence: MEGDGGTPWALALLRTFDAGEFTGWEKVGSGGFGQVYKVRHVHWKTWLAIKCSPSLHVDDRERMELL

• Full Name: receptor-interacting serine-threonine kinase 4
• Calculated Molecular Weight: 784 aa, 86 kDa
• GenBank Accession Number: BC110617
• Gene Symbol: RIPK4
• Gene ID (NCBI): 54101
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q9H4D1
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.