RIT2 Polyclonal antibody, PBS Only

• 

  WB analysis using 12473-1-AP (same clone as 12473-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 12473-1-AP (RIT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 12473-1-PBS in a different storage buffer formulation.

• 

  IP experiment of mouse brain using 12473-1-AP (same clone as 12473-1-PBS)

  IP result of anti-RIT2 (IP:12473-1-AP, 4ug; Detection:12473-1-AP 1:1000) with mouse brain tissue lysate 1800 ug. This data was developed using the same antibody clone with 12473-1-PBS in a different storage buffer formulation.

• 

  IP experiment of rat brain using 12473-1-AP (same clone as 12473-1-PBS)

  IP result of anti-RIT2 (IP:12473-1-AP, 4ug; Detection:12473-1-AP 1:1000) with rat brain tissue lysate 1120 ug. This data was developed using the same antibody clone with 12473-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse brain using 12473-1-AP (same clone as 12473-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12473-1-AP (RIT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12473-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse pancreas using 12473-1-AP (same clone as 12473-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 12473-1-AP (RIT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 12473-1-PBS in a different storage buffer formulation.

RIT2 Polyclonal Antibody for WB, IHC, IP, Indirect ELISA

Cat No. 12473-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, Indirect ELISA

Synonyms

---

Product Information

12473-1-PBS targets RIT2 in WB, IHC, IP, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3160

  Product name: Recombinant human RIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC018060

  Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT

• Full Name: Ras-like without CAAX 2
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018060
• Gene Symbol: RIT2
• Gene ID (NCBI): 6014
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99578
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

RIT2 (AKA: Rin, Ras-like in neurons) is a small, neuronal, ras-like GTPase with enriched expression in SNc DANs (PMID: 38395968). RIT2 is a member of the Ras superfamily that plays important roles in many vital cellular functions, such as differentiation and survival (PMID: 29860660). Rit2 directly interacts with the DA transporter (DAT), and is required for regulated DAT membrane trafficking. In cell culture models, Rit2 is required for EGF- and NGF-mediated neurite outgrowth, NGF-mediated ERK phosphorylation, and cell viability (PMID: 38395968).