RIT2 Polyclonal antibody

• 

  WB analysis using 12473-1-AP

  Various lysates were subjected to SDS PAGE followed by western blot with 12473-1-AP (RIT2 antibody) at dilution of 1:1000 incubated at room temperature for 1.5 hours.

• 

  IP experiment of mouse brain using 12473-1-AP

  IP result of anti-RIT2 (IP:12473-1-AP, 4ug; Detection:12473-1-AP 1:1000) with mouse brain tissue lysate 1800 ug.

• 

  IP experiment of rat brain using 12473-1-AP

  IP result of anti-RIT2 (IP:12473-1-AP, 4ug; Detection:12473-1-AP 1:1000) with rat brain tissue lysate 1120 ug.

• 

  IHC staining of mouse brain using 12473-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse brain tissue slide using 12473-1-AP (RIT2 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

• 

  IHC staining of mouse pancreas using 12473-1-AP

  Immunohistochemical analysis of paraffin-embedded mouse pancreas tissue slide using 12473-1-AP (RIT2 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0).

RIT2 Polyclonal Antibody for WB, IP, IHC, ELISA

Cat No. 12473-1-AP

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, IP, ELISA

Synonyms

GTP binding protein Rit2, Ras like without CAAX 2, RIBA, RIN, RIT2, ROC2

---

Tested Applications

• Positive WB detected in: rat brain tissue
• Positive IP detected in: mouse brain tissue, rat brain tissue
• Positive IHC detected in: mouse pancreas tissue, mouse brain tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Western Blot (WB): WB : 1:500-1:2000
• Immunoprecipitation (IP): IP : 0.5-4.0 ug for 1.0-3.0 mg of total protein lysate
• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

12473-1-AP targets RIT2 in WB, IHC, IP, ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag3160

  Product name: Recombinant human RIT2 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 1-217 aa of BC018060

  Sequence: MEVENEASCSPGSASGGSREYKVVMLGAGGVGKSAMTMQFISHQFPDYHDPTIEDAYKTQVRIDNEPAYLDILDTAGQAEFTAMREQYMRGGEGFIICYSVTDRQSFQEAAKFKELIFQVRHTYEIPLVLVGNKIDLEQFRQVSTEEGLSLAQEYNCGFFETSAALRFCIDDAFHGLVREIRKKESMPSLMEKKLKRKDCLWKKLKGSLKKKRENMT

• Full Name: Ras-like without CAAX 2
• Calculated Molecular Weight: 217 aa, 25 kDa
• Observed Molecular Weight: 25-28 kDa
• GenBank Accession Number: BC018060
• Gene Symbol: RIT2
• Gene ID (NCBI): 6014
• RRID: AB_3669140
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q99578
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Background Information

RIT2 (AKA: Rin, Ras-like in neurons) is a small, neuronal, ras-like GTPase with enriched expression in SNc DANs (PMID: 38395968). RIT2 is a member of the Ras superfamily that plays important roles in many vital cellular functions, such as differentiation and survival (PMID: 29860660). Rit2 directly interacts with the DA transporter (DAT), and is required for regulated DAT membrane trafficking. In cell culture models, Rit2 is required for EGF- and NGF-mediated neurite outgrowth, NGF-mediated ERK phosphorylation, and cell viability (PMID: 38395968).