RLN3 Polyclonal antibody

• 

  IHC staining of human stomach using 26075-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 26075-1-AP (RLN3 antibody) at dilution of 1:200 (under 10x lens).

• 

  IHC staining of human stomach using 26075-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 26075-1-AP (RLN3 antibody) at dilution of 1:200 (under 40x lens).

RLN3 Polyclonal Antibody for IHC, ELISA

Cat No. 26075-1-AP

Publications(2)

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA

Synonyms

H3, INSL7, Insulin like peptide 7, Insulin like peptide INSL7, Insulin-like peptide 7

---

Tested Applications

• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Published Applications

• IF: See 2 publications below

Product Information

26075-1-AP targets RLN3 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23382

  Product name: Recombinant human RLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-142 aa of BC140935

  Sequence: AAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPVVLRGSRDVLAGLSSSCCKWGCSKSEISSLC

• Full Name: relaxin 3
• GenBank Accession Number: BC140935
• Gene Symbol: RLN3
• Gene ID (NCBI): 117579
• RRID: AB_2880364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXF3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Stem Cells Transl Med; 3D Spheroids Facilitate Differentiation of Human Adipose-Derived Mesenchymal Stem Cells into Hepatocyte-Like Cells via p300-Mediated H3K56 Acetylation; Authors - Yanrong Yu
	IF	Poult Sci; Expression of relaxin-3 and its receptors in the hypothalamic-pituitary-ovary axis in layers and broiler breeders; Authors - Kahina Boukherroub