RLN3 Polyclonal antibody

• Home
• Products
• Primary Antibodies
• RLN3 Polyclonal antibody (26075-1-AP)

RLN3 Polyclonal Antibody for IHC, ELISA

Cat No. 26075-1-AP Copied!

Publications (2)

Download datasheet

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse

Applications

IHC, IF, ELISA

Synonyms

H3, INSL7, Insulin like peptide 7, Insulin like peptide INSL7, Insulin-like peptide 7

• 

  IHC staining of human stomach using 26075-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 26075-1-AP (RLN3 antibody) at dilution of 1:200 (under 10x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy
• 

  IHC staining of human stomach using 26075-1-AP

  Immunohistochemical analysis of paraffin-embedded human stomach tissue slide using 26075-1-AP (RLN3 antibody) at dilution of 1:200 (under 40x lens).

  This validation data has been generated in-house and reviewed by Proteintech scientists. Find out more on our antibody validation policy

Able AI

What's the best dilution for RLN3 in ?

Chat with Able

---

Tested Applications

• Positive IHC detected in: human stomach tissue; Note: suggested antigen retrieval with TE buffer pH 9.0; (*) Alternatively, antigen retrieval may be performed with citrate buffer pH 6.0

Recommended dilution

• Immunohistochemistry (IHC): IHC : 1:50-1:500

It is recommended that this reagent should be titrated in each testing system to obtain optimal results.

Sample-dependent, Check data in validation data gallery.

Product Information

26075-1-AP targets RLN3 in IHC, IF, ELISA applications and shows reactivity with human, mouse samples.

• Tested Reactivity: human, mouse
• Cited Reactivity: human
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag23382

  Product name: Recombinant human RLN3 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 27-142 aa of BC140935

  Sequence: AAPYGVRLCGREFIRAVIFTCGGSRWRRSDILAHEAMGDTFPDADADEDSLAGELDEAMGSSEWLALTKSPQAFYRGRPSWQGTPVVLRGSRDVLAGLSSSCCKWGCSKSEISSLC

• Full Name: relaxin 3
• GenBank Accession Number: BC140935
• Gene Symbol: RLN3
• Gene ID (NCBI): 117579
• RRID: AB_2880364
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: Q8WXF3
• Storage Buffer: PBS with 0.02% sodium azide and 50% glycerol, pH 7.3.
• Storage Conditions: Store at -20°C. Stable for one year after shipment. Aliquoting is unnecessary for -20^oC storage. 20ul sizes contain 0.1% BSA.

Publications

What published studies show

The RLN3 Polyclonal antibody (Cat# 26075-1-AP) has 2 total citations. These appear in Stem Cells Translational Medicine and Poultry Science. The cited research spans stem cell biology and epigenetics (H3K56 acetylation in mesenchymal stem cell differentiation) and reproductive endocrinology (relaxin-3 expression in the hypothalamic-pituitary-ovary axis of broiler breeders). Both citations used the antibody for immunofluorescence (IF) applications.

Automatically generated from the 2 publication citations by Able AI.

• Human
• Mouse
• Rat
• Monkey
• Pig

Species	Application	Title
human	IF	Stem Cells Transl Med; 3D Spheroids Facilitate Differentiation of Human Adipose-Derived Mesenchymal Stem Cells into Hepatocyte-Like Cells via p300-Mediated H3K56 Acetylation; Authors - Yanrong Yu
	IF	Poult Sci; Expression of relaxin-3 and its receptors in the hypothalamic-pituitary-ovary axis in layers and broiler breeders; Authors - Kahina Boukherroub