RNASE4 Polyclonal antibody, PBS Only

• 

  WB analysis using 30732-1-AP (same clone as 30732-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30732-1-AP (RNASE4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30732-1-PBS in a different storage buffer formulation.

• 

  WB analysis using 30732-1-AP (same clone as 30732-1-PBS)

  Various lysates were subjected to SDS PAGE followed by western blot with 30732-1-AP (RNASE4 antibody) at dilution of 1:600 incubated at room temperature for 1.5 hours. This data was developed using the same antibody clone with 30732-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 30732-1-AP (same clone as 30732-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 30732-1-AP (RNASE4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30732-1-PBS in a different storage buffer formulation.

• 

  IHC staining of rat lung using 30732-1-AP (same clone as 30732-1-PBS)

  Immunohistochemical analysis of paraffin-embedded rat lung tissue slide using 30732-1-AP (RNASE4 antibody) at dilution of 1:200 (under 40x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30732-1-PBS in a different storage buffer formulation.

• 

  IHC staining of mouse bladder using 30732-1-AP (same clone as 30732-1-PBS)

  Immunohistochemical analysis of paraffin-embedded mouse bladder tissue slide using 30732-1-AP (RNASE4 antibody) at dilution of 1:200 (under 10x lens). Heat mediated antigen retrieval with Tris-EDTA buffer (pH 9.0). This data was developed using the same antibody clone with 30732-1-PBS in a different storage buffer formulation.

RNASE4 Polyclonal Antibody for WB, IHC, Indirect ELISA

Cat No. 30732-1-PBS

Host / Isotype

Rabbit / IgG

Reactivity

human, mouse, rat

Applications

WB, IHC, Indirect ELISA

Synonyms

---

Product Information

30732-1-PBS targets RNASE4 in WB, IHC, Indirect ELISA applications and shows reactivity with human, mouse, rat samples.

• Tested Reactivity: human, mouse, rat
• Host / Isotype: Rabbit / IgG
• Class: Polyclonal
• Type: Antibody
• Immunogen:

  CatNo: Ag29272

  Product name: Recombinant human RNASE4 protein

  Source: e coli.-derived, PGEX-4T

  Tag: GST

  Domain: 29-147 aa of BC015520

  Sequence: QDGMYQRFLRQHVHPEETGGSDRYCNLMMQRRKMTLYHCKRFNTFIHEDIWNIRSICSTTNIQCKNGKMNCHEGVVKVTDCRDTGSSRAPNCRYRAIASTRRVVIACEGNPQVPVHFDG

• Full Name: ribonuclease, RNase A family, 4
• Observed Molecular Weight: 17-20 kDa
• GenBank Accession Number: BC015520
• Gene Symbol: RNASE4
• Gene ID (NCBI): 6038
• Conjugate: Unconjugated
• Form: Liquid
• Purification Method: Antigen affinity purification
• UNIPROT ID: P34096
• Storage Buffer: PBS only, pH 7.3.
• Storage Conditions: Store at -80°C.

Background Information

Human Ribonuclease 4 (RNase 4), one of the eight members of the human RNase A superfamily of endoribonucleases, is a uridine-specific endoribonuclease with a preference to cleave RNA after uridine residues prior to purines (PMID: 33818125). RNase 4 is a newly identified host defense peptide in the human kidney and bladder and kills uropathogenic E. coli (UPEC) and multi-drug resistant UPEC (PMID: 28955965).